KEGG   Mus musculus (mouse): 12816
Entry
12816             CDS       T01002                                 

Gene name
Col12a1
Definition
(RefSeq) collagen, type XII, alpha 1
  KO
K08132  collagen type XII alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12816 (Col12a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12816 (Col12a1)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Others
   12816 (Col12a1)
Motif
Pfam: fn3 VWA VWA_2 Collagen Interfer-bind Pur_ac_phosph_N DUF4998 VWA_3 Copine Toxin_R_bind_N
Other DBs
NCBI-GeneID: 12816
NCBI-ProteinID: NP_001277237
MGI: 88448
Ensembl: ENSMUSG00000032332
Vega: OTTMUSG00000021365
UniProt: Q60847
Position
9 E1; 9 43.82 cM
AA seq 3065 aa
MQTRLPRALAALGVALLLSSIEAEVDPPSDLNFKIIDENTVHMSWERPVDPIVGYRITVD
PTTDGPTKEFTLAASTTETLLSDLIPETQYVVTITSYNEVEESVPVIGQLTIQTGGPTKP
GEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIVALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYRREDLLAAVKKIPYKGGNTMTGDAIDYLVKNTFTESAGSRAG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLVVTELSSKYIRLSWDPSPSA
VTGYKILLTPMAAGSRHHALSVGPQTTTLNVRDLTADTEYQISVFAMKGLTSSEPTSVME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLAKSFEISPNRVQIS
LVQYSRDPHTEFTLKEFNRVEDIIKAINTFPYRGGSTNTGKAMTYVREKIFVPNKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLRFTQVTANSFKAEWSPPGDNVF
SYHVTYKDANGDDEVTVVEPASSTSVVLNNLRPETLYLVNVTAEYEDGFSVPITGEETTA
EVKGVPRNLKVTDETTDSFKLTWSQAPGRVLRYRIRYRPVSGGESKEVSTPANQRRKTLE
NLTPDTKYEISVIAEYSSGPGSPLTGNAATEEVRGNPRDLRVSDATTSTLKLSWSRAPGK
VKQYLVTYTPAAGGETQEVTVRGDTTTTMLRKLKEGTQYDLSVTALYASGAGEALSGKGS
TLEERGSPQNLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIEAGETTLPGDAIHT
MIENLQPETKYKISVFATYSSGEGEPVTGDATTELSQDSKILRVDEETEHTMRVTWKAAP
GKVVNYRVVYRPQGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPMYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVLGPYDN
TVVLEELRAGTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMDCLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWQLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDTHAYNVADFESLSKIVDDLTINLCNSVK
GPGDLEAPTNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLDTSTV
LKDLKPETDYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDVGPTTMHVQWQPVGGA
TGYTVSYQPTRSPEGTKPKEMRVGPTVNDVQLTGLLPNTEYEVTVQAVLYDLTSEPAKAR
EVTLPLPRPQDVKLRDVTHSTMNVVWEPVLGKVRKYIVRYKTPDEEFKEVEVDRSRASTI
LKDLSSQTQYTVSVSAVYDEGTSPPATAYDTTRRVPAPTNLQFTEVTPESFRGTWDHGAS
DVSLYRITWAPVGNPDKMETILNGDENTLVFENLNPNTPYEVSITAIYPDESESEDLSGT
ERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQT
ITVGGRQNSVLLQKLKPDTPYTITVYSQYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
SLSVRWDHAEGNPRQYKLFYAPTSGGPEELVPIPGNTNYAILRNLQPDTPYTITVVPVYT
EGDGGRTSDTGRTLVRGLARNIQVYNPTPNSLDVRWDPAPGPVQQYRIVYSPVAGTRPSE
SIVVPGNTRTVHLERLIPDTPYSVNIVALYSDGEGNPSPSQGRTLPRSGPRNIRVFGETT
NSLSVAWDHADGPVQQYRIIYSPTVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAI
YEDGDGGHLTGNGRTVGLLPPQNIHIFDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEP
MEAFVGEVTSYTLHNLNPSTTYDVSVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQVGWD
TFCVKWSPHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPEAEYGVTVFVQTPN
LEGPGVPIKEQTTVKPTEAPTEPPTPSPPPTIPPARDVCKGAKADIVFLTDASWSIGDDN
FNKVVKFIFNTVGAFDEVNPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRG
GNTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAAFVIQQSGFSVFVV
GVADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLIYLDGYTS
PGFKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRLQKNAFINQPTAELHPNGLPPSYT
IILLFRLLPETPSDPFAIWQITDRDYRPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDTD
EVKTLFYGSFHKVHIVVTSKSVKIYIDCYEIIEKDIKEAGNITTDGYEILGKLLKGERKS
ATFQIQSFDIVCSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGP
GAKGPRGERGINGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPG
LPGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGSPGSPGVTGPSGKPGKPG
DHGRPGQSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSSR
NQPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPPGERGLPGEKGERGTGSQGPRG
PPGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQG
YPGSG
NT seq 9198 nt   +upstreamnt  +downstreamnt
atgcagaccaggcttccccgagcgctggccgccctgggcgtggccctactcctgtcttcc
attgaggcagaagttgacccaccttccgacttgaattttaaaattatagatgaaaatact
gttcatatgtcatgggagagaccagttgatccaattgtgggttacagaataacagtggac
cctacaacagatgggcctactaaagaatttacccttgcagctagtaccactgaaactcta
ttatcagatcttattcctgaaacacagtatgtggtgactataacttcctataatgaagta
gaagaaagtgtgccagtaataggtcaactaacaattcaaacaggtggtcctacaaagcca
ggggagaagaaacctggaaaaacagaaatacaaaagtgctctgtcagtgcctggaccgac
ctagtgtttcttgtggacggctcctggagtgtgggaagaaataatttcaagtacatttta
gacttcattgttgctctggtgtctgcatttgacattggggaggagaagacgagggttgga
gttgttcagtacagctcagataccaggactgaatttaacttaaatcagtattaccgaaga
gaagacctccttgctgcagttaaaaaaataccatacaaaggcggcaacacaatgacaggg
gatgccattgattacttagttaaaaacacttttactgaatctgctggctcacgagctggc
tttcctaaagtggcaattattatcacggacggcaagtctcaggacgaagtggaaattcca
gcgcgggagcttcggaatattggagttgaggttttctctctgggcattaaagctgcagat
gcaaaagaactcaaacaaattgcatccacaccttccctgaaccatgtgttcaatgtggcc
aattttgatgcaattgtggacatccagaatgagataatctcgcaggtgtgttcaggagtt
gatgagcagcttggtgagctggtcagtggagaagaagtcatcgagcctccttcaaatctg
gtagtcactgaactctcatcaaaatacattaggctgagctgggatccgtctcccagcgct
gtgaccggctataagatcctcctcacaccaatggcagcgggaagccggcatcacgctttg
agtgtggggccccagacgaccacgctcaatgttcgtgaccttacagcggacacggagtac
cagatcagcgtttttgccatgaagggcctgacgtccagtgaacccacttcggtcatggag
aagacgcagccaatgaaagttcaagtggaatgttcacgtggtgtggatataaaagctgac
atcgtgtttttggttgatggttcctatagcatcgggattgcaaattttgttaaagttcga
gcctttttagaagttcttgcaaaaagttttgagatttctccgaacagggtgcagataagc
cttgtacagtacagcagggaccctcacaccgagttcacattgaaggagttcaacagagtt
gaagatataatcaaagcaataaacaccttcccgtacaggggaggatccacaaacacaggc
aaagccatgacttatgtcagagagaaaatatttgtgccaaacaaaggttccagaagcaac
gtaccgaaggtgatgattctcatcacagatgggaagtcatcagatgctttcagggatcct
gctataaaactcaggaactccgacgtggagatcttcgcagtcggtgtaaaggacgctgtg
cgctcagaactggaagccattgcctctcctcctgctgagacccacgtgttcacagtggag
gattttgatgcctttcagaggatatcatttgaactcacacagtccatctgtcttagaatt
gagcaagagttggcagctataaagaagaaagcttacgttccaccaaaggatctgaggttt
actcaggtaactgctaatagtttcaaagctgaatggtctcctcctggagacaatgtcttt
tcgtatcacgtcacatacaaggatgctaatggtgatgatgaggtcacagtggtggagcca
gcctccagcactagtgttgttctcaacaacctgaggccagaaaccctgtacttggtgaat
gtgacagccgagtatgaggacggcttcagtgttcctataactggggaggagaccactgca
gaagtaaaaggagttccacgaaacctgaaggtgacagatgagactacggacagttttaaa
cttacctggtcccaagctccagggagagtcttaaggtatcggattagatacagaccagtt
tctggtggagaaagcaaagaagtgagtaccccagccaatcagaggaggaaaacactggag
aatctgacgcccgacacaaaatatgaaatatctgtgattgctgaatattcctcgggacct
ggatctccactgacaggaaatgcagccactgaagaagttagagggaatccaagagaccta
agagtttctgatgctacgacatcaacgctgaagttgtcttggagtagggcaccaggaaag
gtgaagcaatatcttgtcacatacaccccagcagcaggaggtgaaactcaggaggtcact
gtgagaggagatacaaccactaccatgttgaggaaattgaaggaagggacacagtatgac
ttatctgtgacagcactgtatgcgtctggggctggcgaagccctttctggaaaaggatca
actcttgaagaacgtggctcacctcagaacctagttaccaaagacatcacagacacatca
atcggagcctattggacatctgccccagggatggttcgagggtacagggtctcatggaaa
tcgctttacgacgacattgaggctggagagacaactcttcctggagatgcaattcatact
atgatagagaacctgcagccagagaccaagtacaaaatttcagttttcgcaacttacagc
agtggagaaggagagcccgtgaccggagatgccacaactgaattatctcaagattccaaa
atcttaagagtggatgaagaaacagaacacacgatgagagttacctggaaagcagcaccg
gggaaagtcgtcaactaccgtgttgtgtatcgccctcaagggggtgggaggcagatggtt
gctaaggtgccacccacggtcacttcaacagtgctaaagagacttcaaccccagaccaca
tatgacatcacagttctcccaatgtacaagacaggagaaggaaagctcaggcaaggctca
ggaacaacagcgtctcgatttaaatcgccgagaaacctcaaaacttctgacccaaccatg
tcaagtttcagagtgacttgggagcctgcccctggggaagtgaaaggttacaaagtcaca
ttccaccctacaggcgatgacagaagacttggggagttggtccttggaccatatgacaac
acagttgtcttggaggagcttagggcaggcaccacctatagagtcaatgtttttgggatg
tttgatggaggagaaagtttaccactcgttgggcaagaaatgacaactctttctgacaca
actgtgacaccatttctatcttctgggatggattgtctcaccagagctgaagcagacatt
gtgttgctggtggatgggtcatggagcatcggccgtgcaaattttagaactgtgcgaagc
ttcatttctcgtattgtagaagtctttgaaattggccccaaaagagtacaaattgctctc
gctcagtacagtggagaccccagaacagagtggcagttaaatgctcatagagacaagaag
agtttattacaggctgtggcgaacttaccatacaaaggaggaaataccctcacaggcatg
gctttgaatttcattcgccaacagagcttcaagactcaagctggcatgaggcctcgtgct
cgcaaaattggagttctcattaccgatggaaaatcacaagatgatgtggaggctccatcc
aagaaactcaaggatgaaggcgtggagctgtttgctattggtattaagaatgctgatgaa
gttgagttaaagatgattgccactgatccagatgacactcacgcatacaatgtggcagat
tttgagtcattgtccaagattgtggatgacctcaccatcaacttgtgtaacagtgtcaag
ggccctggtgacttggaagcaccgactaacttagtaatttcagagagaactcaccgttct
tttagagtgagctggacacccccttctgacagtgtggacagatacaaggtggaatactac
cctgtctctggagggaaacgccaggagttttatgtgagtcgactagacactagcacagtg
ctgaaggacctgaagcctgagactgactatgtggtgaacgtgtactctgtggttgaagat
gagtacagtgagcctctgaagggcacagagaaaaccctgccagtccctgtagttagcctg
aatatttatgatgttggccccaccactatgcatgtgcaatggcagcctgtgggaggagct
actggctacaccgtatcataccaacctactcgatctccagaaggaacaaagcccaaagag
atgcgcgtggggccaacagtgaatgatgtgcagctgactggcctccttcctaacacagag
tatgaggtcaccgtccaggccgtcctgtatgacctcactagtgaacctgccaaagctcgg
gaagtcacattgcctttacccagacctcaggatgtgaaactcagagatgtgacccacagc
accatgaatgtcgtctgggaacctgtgcttggaaaagttcgcaagtacattgttagatac
aaaactccagatgaggagttcaaagaggtggaggtggacagatcaagggccagcactatc
ctcaaagacctctcctctcaaacccagtacacagtgagcgtttctgctgtgtacgatgag
ggcacatctcccccagcaactgcatatgacacaacccggcgtgttccagccccaaccaac
ctccagtttactgaagtcacaccagagagtttcagggggacctgggatcatggagcttca
gatgtgtctctctacaggataacttgggcacctgttgggaacccagataagatggagacc
attttaaatggagatgaaaatactttggtgtttgaaaatctgaaccccaatactccgtat
gaagtctccatcaccgccatctatcctgatgagtctgaaagcgaggacctgagtggcaca
gagcgcacactgcgtctgatacccttaacaacacaagctccaaaaagtggtccacggaac
cttcaggtgtacaatgccacatctaacagcttgactgttaagtgggatcctgctagtggt
cgtgtgcagaagtacagaatcacctatcagccttcaacaggagaaggcaatgaacaaacg
atcacagtaggaggacggcagaacagcgtgctcctgcagaaactgaagcctgacactcca
tacaccatcacggtgtattcccagtatcccgatggtgaaggtggccggatgaccggaagg
ggaaagaccaaacctctgaataccgtgaggaatttgagagtgtatgacccgtctaccagc
tctttgagtgtccgctgggaccatgcagaaggcaatcctcgtcagtacaaactcttttat
gccccaacatcaggtggcccagaagaactggtcccaatccccgggaataccaactatgcc
attcttaggaacctgcagccagatactccatacaccatcacagtggttccggtctataca
gaaggtgatggcgggcgcacatcagatactggaaggacattggtgagaggactggcaaga
aacatccaagtgtataaccctacgcccaacagccttgatgttcgctgggaccccgcccca
gggccagtgcagcagtaccgcattgtgtactcccctgttgctggtacaagaccctcagaa
tctattgtggtgccagggaatacccgaacggtgcatctggagaggttgattcctgacaca
ccctactctgtgaatatcgtggctctctactcagatggagaggggaatcccagccccagc
cagggccgaacacttccaagaagtggaccaaggaacatacgggtctttggggagacgacc
aacagcctctctgtagcctgggaccatgctgatgggccagttcagcaatacaggatcatc
tactctcctactgtcggcgatccaattgatgaatataccacagttccaggcagaagaaac
aatgtaatactgcagcccttgcaacctgacactccatataaaattactgtcattgctatt
tatgaggatggagatggtggtcacctaactggaaacgggaggactgtgggtctgcttcct
cctcagaacatacacatcttcgatgaatggtacacaaggttccgagtgtcctgggaccct
tcaccctcaccagttcttggatataaaattgtgtacaagccagtgggttccaatgagccc
atggaagcctttgttggagaagtgacatcatacactttacacaacctcaatcccagcact
acctatgacgtcagtgtttatgcacagtatgactctggactcagcgttcccctcacagat
caaggcaccacattgtacttaaatgtgacagatctgaaaacttaccaggttggatgggat
acattctgtgtcaagtggtcacctcaccgggcagccacctcctacaggctaaagctgagt
cctgcagatggaaccaggggacaagaaataaccgtgcgaggatcagagaccagtcattgc
ttcactggtctctccccggaggctgagtacggcgttactgtttttgtgcagacaccaaat
ctcgaggggccgggtgtccccatcaaagaacagaccactgtgaaaccaacagaggctcct
acagaaccacccacgccttctcctcctcccactattccacctgcccgtgatgtatgcaaa
ggggccaaggcagatattgtgttcttgacggatgcctcttggagtattggagatgacaat
tttaacaaagttgtaaaatttatctttaatactgtgggggcctttgatgaagtcaaccct
gctgggattcaggtttcttttgtgcagtacagtgatgaggtcaagtctgaattcaagctg
aacacatacaacgataaagctctagccctcggagccctccagaacattcgctacagagga
ggaaacacaagaacaggcaaggccctcacatttatcaaggagaaggtcttgacctgggag
agcggcatgagaaagaatgtcccgaaggtgctggttgtggtcacagatggccggtcgcag
gatgaggtgaagaaggcagcctttgtcatccagcagtcagggttcagtgtattcgttgtt
ggtgtggctgatgtggactacaacgagcttgccaacattgccagcaagcccagcgagagg
catgtattcatcgtggatgactttgaatcttttgagaagattgaggacaatctgatcaca
tttgtttgtgaaactgccacttcaagttgccctctcatctatctggatggctacacatca
ccaggctttaagatgcttgaagcttacaacctgacagaaaagaattttgcttctgtccaa
ggagtctctttggaatccggatctttccctagctattcagcctacagacttcagaagaat
gcctttatcaatcagcccacagcagaactgcatccaaatggactccctccttcgtacacg
attatattattatttagacttctcccagaaactcctagtgacccctttgcaatttggcaa
attacagacagagactacagaccacaagttggagtgattgcagatccttccagcaagaca
ctatctttctttaataaggatacaagaggggaggtacaaactgttacatttgacacagat
gaagtgaagacattattttatggaagctttcataaggtccatattgtagtgacctcaaag
agtgttaagatttatattgactgctatgaaattatagaaaaagacatcaaagaagctgga
aatataacaactgatggctacgaaattcttggaaaacttcttaaaggagagaggaagtca
gccacattccaaatccagagctttgacattgtctgcagcccagtgtggaccagtagagac
agatgctgtgatattccctctaggagagatgaagcaaaatgccctgcccttccgaatgct
tgcacgtgtacccaggacagcgttggacctccaggccctccgggccctgcaggaggacct
ggcgcaaaaggtcccagaggtgaaagaggcatcaatggggcagttgggcccccaggtccc
cgtggagatactggccctccaggccctcaaggtcctccaggcccccagggacccaatgga
ctctccattccgggcgaacagggtcgccagggaatgaaaggtgatgcaggagagccaggc
cttccgggacggacaggaaccccaggattacctggcccaccaggaccaatgggaccacca
ggagacagaggtttcactggaaaagatggtgcaatggggcccagaggtcccccggggcca
ccgggaagcccaggctctccaggagtcacagggccaagtgggaaaccaggaaaacctgga
gaccatggcagacctggtcaatctggcttaaaaggagaaaaaggtgataggggagacatc
gcttcccagaacatgatgcgagcggttgcaagacaagtctgcgaacaactgatcagtggc
cagatgagcagattcaatcagatgctgaatcagattccaaatgattaccactcaagtcga
aaccagcctggcccaccagggcctccagggccccctggcagtgctggagccagaggagaa
ccagggcctgggggtcgaccaggattccctggcacacctgggatgcaaggaccccctggt
gaacgaggtttgcctggagagaaaggtgaaaggggtactgggtctcaaggaccccgagga
ccgcctgggcccccaggtccacaaggcgaatcccgaacgggtccaccagggtctacaggt
tcaagaggccctcctggtccccctggtcgtccaggaaactcaggtatccgaggccctcca
ggtcctcctggatattgtgattcatcccagtgtgccagcatcccgtacaatgggcaaggc
tatccaggttccggctaa

DBGET integrated database retrieval system