KEGG   Mus musculus (mouse): 12817Help
Entry
12817             CDS       T01002                                 

Gene name
Col13a1
Definition
(RefSeq) collagen, type XIII, alpha 1
  KO
K16617  collagen, type XIII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12817 (Col13a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12817 (Col13a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12817 (Col13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 12817
NCBI-ProteinID: NP_031757
MGI: 1277201
Ensembl: ENSMUSG00000058806
Vega: OTTMUSG00000021424
UniProt: Q9R1N9
Position
10 32.29 cM; 10 B4
AA seq 739 aa AA seqDB search
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAH
FRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDEKWKFYSRRRREAPKMSPGCNCPPG
PPGPTGRPGLPGDKGAIGMPGRVGIKGQPGEKGAPGDAGMSIVGPRGPPGQPGTRGFPGF
PGPIGLDGRPGHPGPKGEMGLVGPRGQPGPQGQKGEKGQCGEYPHREYPGGMLAALRSNP
IMSLKLLPLLNSVRLAPPPVIKRRTFQGEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPI
GPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGVPGIAVAGMKGEPGTPGTKG
EKGAAGSPGLLGQKGEKGDAGNAIGGGRGEPGPPGLPGPPGPKGEAGVDGQAGPPGQQGD
KGQPGAAGEQGPSGPKGAKGEPGKGEMVDYNGSINEALQEIRTLALMGPPGLPGQTGPPG
PPGTPGQRGEIGLPGPPGHDGDKGPRGKPGDMGPAGPQGPPGKDGPPGMKGEVGPPGSPG
EKGETGQAGPQGLDGPTGEKGEPGDEGRPGATGLPGPIGLPGFTGEKGEAGEKGDPGAEV
PGPPGPEGPPGPPGLQGFPGPKGEAGLEGSKGEKGSQGEKGDRGPLGLPGTPGPIGVPGP
AGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGL
DAPCPLGEDGLPVQGCWNK
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggagcgcacccgcaaagcggcagcctctggcagccgcggccctggggagctg
ggcgctccggggcccgggacagtggcgctggctgagcagtgcgctaggctgccgagcccc
gggtgctgcggactgctggctctagcgctgtgttcgctggcgctcagcctgctcgcccac
tttcggaccgcggagctgcaggcccgggtgctgcgcttggaagcagagcgcggggagcag
cagatggagaaagctattttgggacgagtcaaccaactgctggacgagaaatggaagttc
tactcgcgtaggcgccgggaagccccgaagatgtctccaggatgtaactgcccaccagga
cctcctggtcccactggaagacctggactcccaggggacaagggtgccatcgggatgcct
ggacgtgtgggtatcaaaggtcaaccaggcgagaagggtgcccctggagatgcggggatg
tccatcgtcgggcctcgaggcccccctggccagcctggtacccgaggtttccctggattc
ccgggtcccattggtcttgacggcaggccgggccaccccggacctaaaggggagatgggc
ctggtgggtcctcgaggacaaccgggacctcagggacaaaagggagaaaagggtcagtgt
ggagagtacccacacagggagtacccaggcggcatgctagcagctctgcgctccaacccg
ataatgtccctaaagctgttgcctctactcaattcagtgcggctggctccacccccagtc
attaaaaggcggacctttcagggggaacaaagtcagactggcatccaaggccctccaggg
ccaccgggccccccaggaccaagtggccctctgggacacccaggactgccagggcctata
gggccacctggtttaccggggcctcctggaccaaagggagacccagggatccagggctat
catggccgcaagggagagcggggcatgccaggaatgccaggcaagcacggagccaagggg
gttcctgggattgccgtggctgggatgaagggtgagccagggacgccaggaaccaagggt
gagaagggtgcagcaggctcccctggcctcctggggcagaagggagaaaaaggtgatgct
ggcaatgccatcggaggaggcaggggggagcctggccccccggggctccctgggccccct
gggccaaagggagaagctggtgttgatggccaggctgggcccccaggacagcaaggagac
aaggggcagccaggagcagctggtgaacagggaccctctggccccaagggtgccaagggt
gaacccggcaaaggagagatggtggattataatggcagcatcaacgaggcgcttcaggag
atcaggacgctggccttgatggggcctcctggtcttcctggacaaacaggcccacccgga
cctccagggactccaggccaaaggggggagattggactgccaggccctccaggacacgat
ggggacaaggggcctcgaggaaaaccaggagatatggggccggctggtcctcaaggaccc
ccaggaaaggatgggcctccaggaatgaagggagaagtcggacccccaggaagtccaggg
gagaaaggggagacaggacaagcaggcccccagggtctagacggcccaactggggagaaa
ggagaaccaggtgacgaagggaggcctggagcgacaggattgcctgggcccatcgggctc
ccgggattcacaggagagaaaggagaagctggggagaaaggcgacccgggagcagaggtt
cctgggccgccagggccagagggtcctccaggacctccgggcctccaaggttttcctgga
ccaaagggagaagcaggcctagagggcagtaaaggagagaagggctcccagggagaaaaa
ggagaccgggggcctctgggattgcctggtactccaggaccaatcggggttccaggccca
gccggaccaaagggcgaaaggggcagcaaaggcgacccagggatgacgggaccaacggga
gcagctgggctgcctggtttacatggaccacccggggacaaaggaaaccggggggagagg
gggaagaagggctctagagggcctaaaggggacaagggggaccaaggagcacctggacta
gacgccccctgcccgctgggagaagatggcttaccagtccaaggctgctggaacaagtga

DBGET integrated database retrieval system