KEGG   Mus musculus (mouse): 12819
Entry
12819             CDS       T01002                                 

Gene name
Col15a1
Definition
(RefSeq) collagen, type XV, alpha 1
  KO
K08135  collagen type XV alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12819 (Col15a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12819 (Col15a1)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   12819 (Col15a1)
SSDB
Motif
Pfam: Endostatin Collagen Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 12819
NCBI-ProteinID: NP_034058
MGI: 88449
Ensembl: ENSMUSG00000028339
Vega: OTTMUSG00000006798
UniProt: O35206
Structure
PDB: 
1DY2

Position
4; 4 B1
AA seq 1367 aa
MTHRRTAQGRRPRWLLSIISALLSAVLQTRAATGSASQVHLDLTVLIGVPLPSSVSFTTG
YGGFPAYSFGPGANVGRPARTLIPPTFFRDFAIGVAVKPNSAQGGVLFAITDAFQKVIYL
GLRLSSVEDGRQRVILYYTEPGSHVSREAAVFSVPVMTNRWNRFAVTVQGEEVALFMDCE
EQSQVRFQRSSWPLTFEPSAGIFVGNAGAMGLERFTGSIQQLTIYSDPRTPEELCEAQES
SASGEASGFQEMDEVAEIMEAVTYTQAPPKESHVDPISVPPTSSSPAEDSELSGEPVPEG
TPETNLSIIGHSSPEQGSGEILNDTLEVHAMDGDPGTDDGSGDGALLNVTDGQGLSATAT
GEASVPVTTVLEAENGSMPTGSPTLAMFTQSIREVDTPDPENLTTTASGDGEVPTSTDGD
TEADSSPTGGPTLKPREEATLGSHGEEWLTPAVSKMPLKAFEEEEASGTAIDSLDVIFTP
TVVLEQVSRRPTDIQATFTPTVVLEETSGAPTDTQDALTPTVAPEQMFTAEPTDGGDLVA
STEEAEEEGSGSMPPSGPPLPTPTVTPKRQVTLVGVEAEGSGPVGGLDEGSGSGDIVGNE
DLLRGPPGPPGPPGSPGIPGKPGTDVFMGPPGSPGEDGAPGEPGPQGPEGQPGLDGASGQ
QGMKGEKGARGPNGSAGEKGDPGNRGLPGPPGKNGEVGTPGVMGPPGPPGPPGPPGPGCT
TELGFEIEGSGDVRLLSKPTISGPTSPSGPKGEKGEQGAKGERGADGTSTMGPPGPRGPP
GHVEVLSSSLINITNGSMNFSDIPELMGPPGPDGVPGLPGFPGPRGPKGDTGVPGFPGLK
GEQGEKGEPGAILTGDVPLEMMKGRKGEPGIHGAPGPMGPKGPPGHKGEFGLPGRPGRPG
LNGLKGAKGDRGVTLPGPPGLPGPPGPPGPPGAVVNIKGAVFPIPARPHCKTPVGTAHPG
DPELVTFHGVKGEKGSWGLPGSKGEKGDQGAQGPPGPPVDPAYLRHFLNSLKGENEDASF
RGESSNNLFVSGPPGLPGYPGLVGQKGEAVVGPQGPPGIPGLPGPPGFGRPGVPGPPGPP
GPPGPPAILGAAVALPGPPGPPGQPGLPGSRNLVTALSDMGDMLQKAHLVIEGTFIYLRD
SGEFFIRVRDGWKKLQLGELIPIPADSPPPPALSSNPYQPQPPLNPILSANYERPVLHLV
ALNTPVAGDIRADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQ
VLFNNWDSIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEA
WRTTDMAVTGFASPLSTGKILDQKAYSCANRLIVLCIENSFMTDTRK
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgacacacaggaggaccgcgcagggccggcgcccgaggtggctgctctccatcatctcc
gcgctgctctccgctgtcctgcagacccgcgctgcgacagggtcagcctctcaggttcac
ctggacctcacagtgctcattggtgtcccattaccctcgtctgtgtcctttaccaccggc
tatggcggtttcccggcttacagctttgggcctggtgccaacgttggccgcccagccagg
accctcatcccaccgaccttcttcagggatttcgccattggtgtggcggtgaagcccaat
agcgcccaagggggcgtgctcttcgctattaccgatgctttccagaaagtcatctacctg
ggcctgcggctttcaagtgtggaggatgggcgccagcgggttatcctctactacacggaa
ccaggctcccacgtgtcccgtgaagctgcggttttctccgtgcccgtgatgaccaacagg
tggaatcgttttgctgtgaccgtccagggcgaagaagttgctcttttcatggactgtgag
gaacagagccaagtccgtttccagcgatcgtcctggcctttgacctttgagcccagtgcc
gggatctttgtgggcaatgctggagctatggggctggagagatttacgggttccatacaa
cagcttaccatctattcagaccccaggacccctgaggagctgtgtgaagcacaagagtcc
tcggcgtctggagaagccagtgggtttcaggagatggatgaagtcgctgaaatcatggaa
gctgtcacctacacacaagccccgcctaaagaatcacacgttgatcccataagcgtgccc
cctacttcatcctctcctgccgaggactcggagctttctggtgagccggtaccagaagga
accccagaaacgaacttgagcatcattggacacagcagccctgagcaagggtctggtgag
atcctgaatgatacgctggaggtccatgcgatggatggggaccctggtactgatgatggt
tcaggggatggagccttgttgaacgtcactgatggtcaggggttatcagcaacagcaact
ggggaggccagtgtgcctgtcaccactgtcctggaagcagagaatggcagtatgcccact
gggagccccaccctggccatgtttacccagagcatcagggaagtggacactccggatcca
gaaaatctaacaacaacagcatcaggggatggtgaggtgcccaccagcactgatggggac
acagaggctgacagctcgcccactggagggccaaccctgaagccaagagaagaggccact
ctgggttcacacggtgaggaatggttaaccccagctgtgtccaaaatgcccctcaaggct
tttgaggaggaggaagccagtgggactgccatcgacagcctggatgtcatcttcacaccc
acggtggtccttgagcaagtcagcaggagacctacagacatccaagccactttcacgccc
acagtggtccttgaagaaaccagcggggcccctacagacacccaggacgctctcacaccc
acagtggcccctgagcaaatgttcactgctgaacccacagatggaggagacttggtggcg
tctacagaggaagctgaagaggagggatctggtagcatgccccccagtgggcccccactc
cccacacccacagtgactcccaagaggcaggtcaccctggtaggagtggaagccgagggg
tcaggccctgttgggggcttggatgagggctcaggctctggagacatcgtgggcaatgag
gatctgctgagaggtccgccgggtcctccaggcccaccgggatcacctgggatcccaggg
aaaccaggaactgatgttttcatgggacccccggggtctcctggggaggatggagctcct
ggtgagccaggaccccagggccccgagggacagcctggacttgatggagcctctggccag
caaggaatgaaaggagagaagggagcaagagggcctaatggttcggctggcgagaagggt
gaccctggaaaccgaggcttaccaggtcccccagggaagaatggagaagttggcacccct
ggggtcatgggaccaccagggcctcctggaccccctgggcctccaggcccgggatgtacc
acagaacttggatttgagattgaaggctctggggacgtccggctgctgagtaaacccaca
atctcaggacccacctctccaagtggtcccaaaggagaaaaaggagagcaaggagccaag
ggtgaacgaggagcggacggaaccagcactatggggccgcctgggcccaggggcccgcct
gggcatgtcgaggtcctgtccagttctttgatcaacatcaccaatggatccatgaatttc
tcagacattcctgagctcatgggacctccggggccagatggtgtacccgggctgccagga
tttccaggccccagaggaccaaaaggtgacaccggtgtgcctggattcccagggctaaaa
ggagaacagggtgagaagggagagcctggagccatcttgactggggacgtccctctggaa
atgatgaaggggagaaagggtgaacctggaatccatggtgcaccgggacccatgggaccc
aaaggaccaccaggacacaaaggagagtttggcctcccaggacgacctggtcgcccagga
ctgaatggcctcaagggtgccaaaggagatcgaggggtcacgctgcctggtccacctggc
ctacctggacccccagggcccccagggccccctggagctgtggttaacatcaaaggcgct
gtttttccaatacctgcccggccacactgcaaaacaccagttggtaccgctcaccctggc
gacccagagcttgtcactttccacggtgttaaaggagaaaaggggtcctggggtcttcct
ggctcaaaaggagaaaagggggaccaaggagctcaaggaccaccaggccctccagtcgat
ccagcttacctgagacattttctcaacagcttgaagggggagaatgaagatgcttcattc
agaggagagtccagcaacaacctctttgtatcagggcctccaggcctaccaggataccca
ggcctggttggacagaaaggagaggctgttgtggggcctcagggacccccaggaattcca
ggcctgcctgggccacctggctttgggagacctggtgttcctggaccaccaggaccccct
gggccaccaggacctcctgccattctgggtgcagctgtggctcttcctggcccacctggc
cctccaggacagccaggactccccggatccagaaacttggtcacagcgctcagcgacatg
ggtgacatgctacagaaagctcacttggtcatagaagggacattcatctacttgagagac
agtggggagtttttcattcgtgtccgagatggttggaaaaagttacagttgggagaactg
atccccattcctgctgatagccccccaccaccagcactttccagcaatccgtatcagcca
caacctccactgaaccccattttaagtgccaactatgagaggcctgttctgcacctggtt
gctctgaacacaccggtggctggggacatccgagctgatttccagtgcttccagcaggcc
agggctgcaggcctcctgtccactttccgagcctttctgtcttcacacctgcaggatctc
tccacagtcgtgcggaaggcagagaggttcggccttccaattgtgaatctcaagggccaa
gtgctttttaacaattgggactcgatattttctggtgatggaggtcaattcaatacacac
attccaatctactcctttgacggtcgggatgtgatgactgatccttcctggccccagaag
gtggtctggcacggctccaacccccatggtgtccgtcttgtggacaagtactgtgaagcc
tggcgaaccacggacatggcagtaaccggatttgcctccccactgagcacagggaagatt
ctggaccagaaagcttacagctgtgctaacaggctaatcgtgctgtgcatcgaaaacagt
ttcatgacagacactaggaagtga

DBGET integrated database retrieval system