KEGG   Mus musculus (mouse): 12822
Entry
12822             CDS       T01002                                 

Gene name
Col18a1, endo
Definition
(RefSeq) collagen, type XVIII, alpha 1
  KO
K06823  collagen type XVIII alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12822 (Col18a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12822 (Col18a1)
   00535 Proteoglycans [BR:mmu00535]
    12822 (Col18a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12822 (Col18a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12822 (Col18a1)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   12822 (Col18a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12822 (Col18a1)
Motif
Pfam: Endostatin Collagen DUF959 Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 12822
NCBI-ProteinID: NP_001103461
MGI: 88451
Ensembl: ENSMUSG00000001435
Vega: OTTMUSG00000021408
UniProt: P39061
Structure
PDB: 
1KOE 1DY0 1DY1

Position
10 C1; 10 39.72 cM
AA seq 1527 aa
MAPDPSRRLCLLLLLLLSCRLVPASADGNSLSPLNPLVWLWPPKTSDSLEGPVSKPQNSS
PVQSTENPTTHVVPQDGLTEQQTTPASSELPPEEEEEEDQKAGQGGSPATPAVPIPLVAP
AASPDMKEENVAGVGAKILNVAQGIRSFVQLWDEDSTIGHSAGTEVPDSSIPTVLPSPAE
LSSAPQGSKTTLWLSSAIPSSPDAQTTEAGTLAVPTQLPPFQSNLQAPLGRPSAPPDFPE
NVAEEVGLLQLLGDPLPEKISQIDDPHVGPAYIFGPDSNSGQVAQYHFPKLFFRDFSLLF
HVRPATEAAGVLFAITDAAQVVVSLGVKLSEVRDGQQNISLLYTEPGASQTQTGASFRLP
AFVGQWTHFALSVDGGSVALYVDCEEFQRVPFARASQGLELERGAGLFVGQAGTADPDKF
QGMISELKVRKTPRVSPVHCLDEEDDDEDRASGDFGSGFEESSKSHKEDTSLLPGLPQPP
PVTSPPLAGGSTTEDPRTEETEEDAAVDSIGAETLPGTGSSGAWDEAIQNPGRGLIKGGM
KGQKGEPGAQGPPGPAGPQGPAGPVVQSPNSQPVPGAQGPPGPQGPPGKDGTPGRDGEPG
DPGEDGRPGDTGPQGFPGTPGDVGPKGEKGDPGIGPRGPPGPPGPPGPSFRQDKLTFIDM
EGSGFSGDIESLRGPRGFPGPPGPPGVPGLPGEPGRFGINGSYAPGPAGLPGVPGKEGPP
GFPGPPGPPGPPGKEGPPGVAGQKGSVGDVGIPGPKGSKGDLGPIGMPGKSGLAGSPGPV
GPPGPPGPPGPPGPGFAAGFDDMEGSGIPLWTTARSSDGLQGPPGSPGLKGDPGVAGLPG
AKGEVGADGAQGIPGPPGREGAAGSPGPKGEKGMPGEKGNPGKDGVGRPGLPGPPGPPGP
VIYVSSEDKAIVSTPGPEGKPGYAGFPGPAGPKGDLGSKGEQGLPGPKGEKGEPGTIFSP
DGRALGHPQKGAKGEPGFRGPPGPYGRPGHKGEIGFPGRPGRPGTNGLKGEKGEPGDASL
GFSMRGLPGPPGPPGPPGPPGMPIYDSNAFVESGRPGLPGQQGVQGPSGPKGDKGEVGPP
GPPGQFPIDLFHLEAEMKGDKGDRGDAGQKGERGEPGAPGGGFFSSSVPGPPGPPGYPGI
PGPKGESIRGPPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTVSVPGPPGPP
GPPGPPGAMGASAGQVRIWATYQTMLDKIREVPEGWLIFVAEREELYVRVRNGFRKVLLE
ARTALPRGTGNEVAALQPPLVQLHEGSPYTRREYSYSTARPWRADDILANPPRLPDRQPY
PGVPHHHSSYVHLPPARPTLSLAHTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQA
RAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPG
ARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRL
LEQKAASCHNSYIVLCIENSFMTSFSK
NT seq 4584 nt   +upstreamnt  +downstreamnt
atggctcccgaccccagcagacgcctctgcctgctgctgctgttgctgctctcctgccgc
cttgtgcctgccagcgctgatgggaattccctgagtcccctgaatcccctggtgtggctc
tggccgcccaagacctctgattctttggaaggcccggtctcgaaaccccagaacagttca
cctgtgcagtccacagagaaccccaccacgcacgtggtcccccaggatggcctcacagaa
caacagacgactcctgccagctccgagctgcccccggaggaagaggaggaggaggatcag
aaagctggccagggtggcagccctgcaacccctgctgtccccattcccctggtggcccct
gctgcgagcccagacatgaaggaggagaatgttgcgggcgttggagccaagattctgaat
gtggctcagggcattcggagcttcgtccagctgtgggatgaggactcgactattgggcac
tctgctgggactgaggttccagattcttcaatccctacagtcctcccctctcctgccgag
ctctccagtgctccccaggggagtaagaccactctctggctaagcagtgccattccaagt
tctccagatgctcagacaactgaggctggcacgctggctgtgcccacccagctgcctccc
ttccagagcaacctccaggcaccactgggaagaccctcagccccaccagacttcccagag
aatgttgctgaggaggtggggctgctgcagctccttggagaccccctacctgagaagatc
tcacaaatcgatgaccctcacgtcgggccggcctacatctttggaccagactccaacagt
ggccaggtggcccagtatcatttcccaaaactcttcttccgggacttttcgctgctgttt
catgtccggccagccacagaggcagcaggggtgctatttgccatcacagatgctgcccag
gtggtagtctcactgggcgtgaagctctcagaggtccgagatggacagcaaaacatctca
ttgctctacacggagcctggggccagccagacccagacgggagccagcttccgcctacct
gcatttgttgggcagtggacacacttcgcgctcagcgtcgacggaggctctgtggctctc
tacgtagactgtgaagaattccagagggtgccatttgctcgggcctcgcagggactggag
ctagagcgtggcgctggcctctttgtgggtcaggctggaacagcagaccctgacaagttc
caggggatgatctcagagctgaaggtacgcaaaaccccccgggtgagccctgtgcactgt
ctggatgaagaagatgatgatgaagaccgggcatctggagattttggaagtggctttgaa
gaaagcagcaagtcacacaaggaggatacatctctactacctgggctccctcagccacct
cctgtcacttccccacccctggctggaggcagcaccacagaagatcctagaacagaagaa
acggaggaagacgccgcggtagattctataggagctgagacccttcctggcacaggttca
agcggtgcatgggatgaggctatccagaaccccggaaggggcttgataaagggaggtatg
aaaggacaaaagggagaaccaggtgcccagggcccacctggcccagctgggccccagggt
cctgccggtccagtggtccagagccccaactcacaacctgtccctggagcacaaggaccc
ccgggacctcaggggccaccagggaaggatggcactccaggaagggatggtgaaccgggt
gaccctggtgaagatgggagaccgggtgacactggacctcaaggctttccagggacccca
ggagatgtgggccctaagggcgagaagggagatcctggtattgggccccgaggacctcca
gggcctccagggccaccaggaccctccttcagacaagacaagctgaccttcattgacatg
gagggatccggtttcagcggagacatagagagccttagaggcccacgaggcttccctggc
cccccggggccccctggtgtcccaggacttcctggtgagccaggacgctttgggatcaat
ggttcctatgcaccaggacctgcaggccttcctggtgtacctgggaaggaaggacccccc
ggttttccaggtcccccgggacctccaggtcctccaggcaaagagggcccaccaggagtg
gccggccagaaaggcagtgttggtgatgtgggcatcccaggacccaaggggagcaaagga
gaccttgggcccatcggtatgcctggcaagtctggcttggctggatcccctgggccagtt
ggacccccaggacctccagggcctccagggccaccaggaccaggatttgctgctggattc
gatgatatggaaggctctggaatacccctctggacaacagcccgaagctctgatgggctg
cagggacctcccgggtcgccgggactcaagggggatcctggagtggcaggcctacctgga
gccaagggagaagttggagcagatggagcccagggcatccctggtcccccaggaagagaa
ggtgcagctggatctccggggccaaaaggagagaaagggatgccgggagaaaagggaaac
ccaggaaaagatggagtgggccggccgggcctccctgggcctccaggacctccagggcct
gtgatctatgtgtcaagtgaggataaagcaatagtgagcacgccaggacctgagggcaag
ccagggtacgcaggctttcctggacctgctggaccgaagggtgacctgggttccaaaggc
gagcagggtcttccggggcccaagggtgagaagggagagccaggcactatctttagtcct
gatggcagagctctgggccatccccagaagggagccaagggagagccaggctttcgagga
cccccgggtccttatggacgacctgggcacaagggtgaaattggcttccctggacggccg
ggtcgacctggaacgaatggcttaaagggagagaaaggagagcctggagatgccagcctt
gggttcagcatgaggggattgcctggcccccctgggcctccaggacccccaggtcctcct
gggatgcccatctatgacagcaatgcatttgtggagtctggccgacctggactaccagga
cagcagggtgtgcaggggccttcaggaccaaagggtgacaaaggagaggtgggcccacct
gggccaccagggcaattccccattgacctcttccacctggaagcggaaatgaagggggac
aagggagaccgaggggatgctggacagaaaggagagaggggagaacctggggctcctggt
ggtggattcttcagctcaagtgtacctggcccccccggcccacctggataccctggaatt
ccgggtccaaagggagagagcatccgggggccacctggccctcctggcccgcagggacct
cctggcattggctatgagggtcgccagggtcccccaggacctccgggacctccaggacct
ccctccttccctggccctcacagacagactgtcagtgttcctggtcctccgggcccacct
ggtcctccaggtcccccaggagccatgggtgcctctgctgggcaggtgaggatctgggcc
acataccagaccatgctggacaagatccgggaggtgccggagggctggctcatctttgtg
gccgagagggaagagctctatgtacgcgttagaaatggcttccggaaggtgctgctggag
gcccggacagccctcccgagaggcacgggcaatgaggtggctgctttgcagcccccattg
gtccagcttcatgagggcagtccatacacccggagggagtactcctattccacggcacga
ccctggcgagcagatgacatcctggccaacccaccgcgcctgccagaccgccagccttac
cccggagttccacatcaccacagttcctatgtgcacctgccgccagcccgccccaccctc
tcacttgctcatactcatcaggactttcagccagtgctccacctggtggcactgaacacc
cccctgtctggaggcatgcgtggtatccgtggagcagatttccagtgcttccagcaagcc
cgagccgtggggctgtcgggcaccttccgggctttcctgtcctctaggctgcaggatctc
tatagcatcgtgcgccgtgctgaccgggggtctgtgcccatcgtcaacctgaaggacgag
gtgctatctcccagctgggactccctgttttctggctcccagggtcaactgcaacccggg
gcccgcatcttttcttttgacggcagagatgtcctgagacacccagcctggccgcagaag
agcgtatggcacggctcggaccccagtgggcggaggctgatggagagttactgtgagaca
tggcgaactgaaactactggggctacaggtcaggcctcctccctgctgtcaggcaggctc
ctggaacagaaagctgcgagctgccacaacagctacatcgtcctgtgcattgagaatagc
ttcatgacctctttctccaaatag

DBGET integrated database retrieval system