KEGG   Mus musculus (mouse): 12823
Entry
12823             CDS       T01002                                 

Gene name
Col19a1
Definition
(RefSeq) collagen, type XIX, alpha 1
  KO
K24340  collagen type XIX alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12823 (Col19a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12823 (Col19a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12823 (Col19a1)
SSDB
Motif
Pfam: Collagen Laminin_G_3
Other DBs
NCBI-GeneID: 12823
NCBI-ProteinID: NP_031759
MGI: 1095415
Ensembl: ENSMUSG00000026141
Vega: OTTMUSG00000021418
UniProt: Q0VF58
Position
1; 1 A5
AA seq 1136 aa
MRHTGSWKLWTWVTTFLLPACTCLTVRDKPETTCPTLRTERYQDDRNKSELSGFDLGESF
ALRHAFCEGDKTCFKLGSVLLIRDTVKIFPKGLPEEYAIAVMFRVRRSTKKERWFLWKIL
NQQNMAQISVVIDGTKKVVEFMFRGAEGDLLNYVFKNRELRPLFDRQWHKLGIGVQSRVL
SLYMDCNLIASRHTEEKNSVDFQGRTIIAARASDGKPVDIELHQLRIYCNANFLAEESCC
NLSPTKCPEQDDFGSTTSSWGTSNTGKMSSYLPGKQELKDTCQCIPNKEEAGLPGTLRSI
GHKGDKGEPGEHGLDGTPGLPGQKGEQGLEGIKGEIGEKGEPGAKGDSGLDGLNGQDGLK
GDSGPQGPPGPKGDKGDMGPPGPPALTGSIGIQGPQGPPGKEGQRGRRGKTGPPGNPGPP
GPPGPPGLQGLQQPFGGYFNKGTGEHGASGPKGEKGDTGLPGFPGSVGPKGHKGEPGEPL
TKGEKGDRGEPGLLGPQGIKGEPGDPGPPGLLGSPGLKGQQGPAGSMGPRGPPGDVGLPG
EHGIPGKQGVKGEKGDPGGRLGPPGLPGLKGDAGPPGISLPGKPGLDGNPGSPGPRGPKG
ERGLPGLHGSPGDTGPPGVGIPGRTGSQGPAGEPGIQGPRGLPGLPGTPGMPGNDGAPGK
DGKPGLPGPPGDPIALPLLGDIGALLKNFCGNCQANVPGLKSIKGDDGSTGEPGKYDPAA
RKGDVGPRGPPGFPGREGPKGSKGERGYPGIHGEKGDEGLQGIPGLSGAPGPTGPPGLTG
RTGHPGPTGAKGDKGSEGPPGKPGPPGPPGVPLNEGNGMSSLYKIQGGVNVPGYPGPPGP
PGPKGDPGPVGEPGAMGLPGLEGFPGVKGDRGPAGPPGIAGISGKPGAPGPPGVPGEQGE
RGPIGDTGFPGPEGPSGKPGINGKDGLPGAQGIMGKPGDRGPKGERGDQGIPGDRGPQGE
RGKPGLTGMKGAIGPVGPAGSKGSTGPPGHQGPPGNPGIPGTPADAVSFEEIKHYINQEV
LRIFEERMAVFLSQLKLPAAMLSAQAHGRPGPPGKDGLPGPPGDPGPQGYRGQKGERGEP
GIGLPGSPGLPGSSAVGLPGSPGAPGPQGPPGPSGRCNPEDCLYPAPPPHQQAGGK
NT seq 3411 nt   +upstreamnt  +downstreamnt
atgaggcacactggctcttggaaattgtggacctgggtgacaaccttcctgcttcctgca
tgtacctgtctgacagtcagggacaagccagaaacaacctgccctacactgagaacagag
agatatcaagatgacagaaacaaatctgaattgtcaggctttgatctgggagaaagcttt
gctctgaggcatgcgttttgcgaaggtgataaaacctgtttcaagttgggaagtgtgctt
cttatcagagacactgttaagatatttcccaaaggccttccagaggaatacgctatagct
gtcatgtttcgggtacgaagaagcaccaaaaaggaacggtggtttttatggaagatttta
aaccagcagaatatggcccagatatctgtagtgattgatggtacgaagaaggtggtagaa
tttatgttccgaggtgctgagggagatctgttgaactatgtttttaagaatcgagaactc
cgtccactctttgatcgtcaatggcataaacttggcattggcgtgcaatcccgagtcctt
tctctctatatggattgcaatttaattgcaagtcgacacacggaagaaaagaattctgtg
gattttcaaggaaggacaattattgctgcacgagcttcagatggcaaacctgtggatatc
gaacttcaccaacttagaatctactgcaatgcaaacttcctagctgaagaatcatgttgc
aacttatcacctactaagtgtccagagcaagacgactttggaagtactacttcatcctgg
gggacctctaacactggtaaaatgtcttcatatctgccaggaaagcaggaacttaaagac
acatgccagtgtattccaaacaaggaggaagcaggattaccaggaactctcagatccatt
ggacataagggcgacaaaggagagccgggtgaacatggcttagatggtactccaggatta
cctggtcaaaagggagaacaaggacttgaaggcatcaagggagaaattggtgaaaagggt
gaaccaggagccaaaggagactctggtctggatggcctcaatggacaagatggtttgaaa
ggtgactcgggtcctcaaggtccacctggcccaaaaggagacaagggtgatatgggacct
ccagggccaccagccttaactggctccataggaatccaaggtccccagggtccacctggc
aaagaaggccaaaggggaagacgagggaaaacaggacccccaggaaatccaggacctcca
ggaccacccggacctcctgggttacaaggactacagcagccttttggtggatatttcaat
aagggaactggtgagcacggagctagtggccccaaaggagaaaagggcgatactgggctg
cctggatttccagggtctgttggccctaaaggacacaaaggagaacctggggagccttta
acaaaaggtgaaaagggagatagaggagaacccggcctattaggaccacagggaataaag
ggggaacctggagatcctggtccccctggtttactaggaagcccagggctaaagggtcag
caaggacctgcaggttccatggggcccagaggaccaccaggagatgttggattgccagga
gaacatggtattccaggaaaacaaggcgttaagggagaaaagggagatccgggtggaagg
ctaggccctcctggacttccaggtctgaagggtgatgctgggcctccagggataagcctg
ccagggaaaccagggttagatggaaatccaggatcacctggtccacgtgggccaaagggt
gaaagaggtctgcctgggctccacggttcccccggggacacaggcccaccaggtgtagga
atccctggtagaacaggctcccaaggaccagccggagagccaggtattcagggtcctcga
ggtctgcctggattgccaggaactccagggatgccagggaatgacggagctccagggaag
gatggaaagccaggccttccaggccccccaggtgacccgatcgcacttcctctcttggga
gacattggagccctgctgaagaacttctgtggcaactgtcaagccaatgtccctgggctg
aaaagcatcaaaggcgatgacggaagcactggggagcctggaaagtatgatcctgcagcc
aggaagggtgatgtagggccacgaggtcctccgggattcccaggcagagaagggccaaag
ggaagcaaaggagagcggggctaccctggaatacacggggagaaaggcgatgagggtctt
caaggaatccctggcctctcgggagctcctggcccaactggaccccctggcttaacagga
agaactggacatcctggtcccactggagcaaaaggtgacaagggtagtgagggaccccct
gggaaacctggacctcctggaccccctggtgtcccgctcaatgagggaaacggcatgagc
agtttatataaaatccagggaggggtgaatgttcccggttacccaggacctccgggcccc
ccaggtccaaaaggtgatcctggcccagtgggagagcctggtgcaatgggcttgccagga
ctagaaggatttcctggtgtaaagggagatcgaggcccagcaggccccccaggcatagcc
ggcatatcgggaaaaccaggtgccccaggccctccaggagtaccaggggagcagggtgaa
agaggacctattggagatacaggttttcctggaccagagggaccctcggggaagccaggc
ataaatggaaaagatggattaccaggtgctcagggcatcatgggtaaacctggcgacaga
ggccccaaaggagaacgcggtgatcagggaattccaggagacagaggccctcaaggtgaa
cgtgggaagccaggtcttacgggcatgaagggggctataggccctgtgggaccagcagga
agcaagggctccactgggccacctggccaccaaggccctccaggcaatcctggcatccct
ggcactccggctgatgctgtttcatttgaagaaataaaacactacattaatcaagaagtc
ctaaggatttttgaagagaggatggctgtgtttctatcccagcttaaactgccagcagca
atgttgtctgctcaagctcatggaaggcctggcccaccagggaaggacgggttacctgga
cccccaggagatccagggccccaaggctaccgaggacagaagggagaaagaggtgaacct
ggaattgggctgccggggagtccgggtcttcctggatcttcagcagtgggtttgccgggc
tcaccaggtgccccggggcctcaaggacccccgggacccagtggaagatgtaatccagaa
gattgcctctatcctgcacctcctccccaccagcaggcaggcgggaagtga

DBGET integrated database retrieval system