KEGG   Mus musculus (mouse): 12824Help
Entry
12824             CDS       T01002                                 

Gene name
Col2a1, Col2, Col2a, Col2a-1, Del1, Dmm, Lpk, M100413, Rgsc413, Rgsc856
Definition
(RefSeq) collagen, type II, alpha 1
  KO
K19719  collagen, type II, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12824 (Col2a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12824 (Col2a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12824 (Col2a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12824 (Col2a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12824 (Col2a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12824 (Col2a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12824 (Col2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC Amnionless
Motif
Other DBs
NCBI-GeneID: 12824
NCBI-ProteinID: NP_112440
MGI: 88452
Ensembl: ENSMUSG00000022483
Vega: OTTMUSG00000021708
UniProt: P28481
Position
15 F1; 15 53.97 cM
AA seq 1487 aa AA seqDB search
MIRLGAPQSLVLLTLLIAAVLRCQGQDAQEAGSCLQNGQRYKDKDVWKPSSCRICVCDTG
NVLCDDIICEDPDCLNPEIPFGECCPICPADLATASGKLGPKGQKGEPGDIRDIIGPRGP
PGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPAGPPGPPGPPGLSAGNFA
AQMAGGYDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPAGKPGDDGEAGKPGKSGERGLPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGSRGEPGNPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQAGEPGIAGFKGDQGPKGETGPAGPQG
APGPAGEEGKRGARGEPGGAGPIGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLTG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLAGAPGLRGLPGKDGETGAAGPPGPSGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKQGDQGIPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGAAGPDGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPSGSTGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGANGNPGPAGPPGPAGKDGPKGVRGDSGPPGRAGDPGLQGPAGAPGEKGEPG
DDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPAGEPGREGSPGADGPPGRDGAAGVKGDRGETGALGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPSGPAGARGIAGPQGPRGDKGESGEQGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGSNGIPGPIGPPGPRGRSGETGPVG
PPGSPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPMQYMRADEADSTLRQHDVEVDATLK
SLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEMRAEGNSRFTYTALKDGCTK
HTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEFGVDIGPVCFL
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagtcgctggtgctgctgacgctgctcatcgccgcggtc
ctacggtgtcagggccaggatgcccaggaggctggcagctgtctgcagaatgggcagagg
tataaagataaggatgtatggaagccctcatcttgccgcatctgtgtgtgtgacactggg
aatgtcctctgcgatgacattatctgtgaagacccagactgcctcaaccccgagatcccc
ttcggagagtgctgtcccatctgcccagctgacctcgccactgccagtggaaaattaggg
ccaaaggggcagaaaggagaacctggagatatcagagatatcataggacccagaggacct
cctggccctcagggacctgcaggtgaacaaggacccagaggtgatcgtggtgacaaggga
gaaaagggtgcgcctggaccccgtggcagagatggagaacctggtacccctggaaatcct
ggccccgctggccctccaggtccccctggtccccctggccttagtgcaggaaacttcgcg
gctcagatggctggagggtatgacgagaaggctggtggtgcccagatgggagtcatgcaa
gggcccatgggccccatgggaccccgtggacccccaggccctgccggtgcccccggccct
caaggatttcaaggcaatcctggtgaacctggcgagcctggtgtctctggtcccatgggt
ccccgaggtcctcctggccctgctggaaaacctggtgacgacggtgaagctgggaagccc
ggaaagtctggggaaagaggcctccctggccctcagggtgctcgtggattcccaggaacc
ccgggtctccccggtgtcaagggtcacagaggttacccaggcctcgacggtgctaagggg
gaagctggtgctccgggtgtgaagggtgagagtggttcccctggtgagaacggatccccg
ggcccaatgggtccccgtggcctgcctggtgagagaggacggactggccctgctggtgct
gctggtgctcggggtaacgatggccagccaggccccgctggacctccgggtcctgtgggt
cccgcaggtggtcctggcttccctggtgctcctggtgccaagggcgaagctggtcccact
ggtgctcgcggtcctgaaggtgctcaaggttctcgtggcgagcctggcaatcctgggtcc
cctgggcctgcaggtgcttctggtaacccagggactgatggtattcctggagccaaagga
tccgctggtgctcctggaattgctggtgcccctggcttccctgggccccgtggccctccc
ggtcctcaaggtgcaactggtccccttggccccaaaggtcaggcgggtgaacctggcatt
gctggctttaaaggtgatcaaggccccaagggagagactggacctgctgggccccaagga
gcccctggccccgctggtgaagaaggcaaacgaggtgctcgaggagagccgggtggtgct
ggaccaatcggaccccctggagagagaggtgctcctggcaaccgtggattcccaggtcaa
gatggtctggcaggtcccaagggtgcccctggagagcgagggcccagtggcttgactggt
cccaagggagccaacggtgacccgggtcgtcctggagaacctggtcttcctggagccagg
ggtcttaccggtcgccctggtgacgctggtcctcaaggcaaagttggtccttctggagcc
cctggtgaagacggtcgccctggacctcctggtcctcagggagctcgtgggcagcctggc
gtcatgggtttccctggccccaaaggtgccaacggcgagcctggcaaagctggtgagaag
ggtctggctggcgctcctggtctgagaggtcttcctggaaaagacggtgagacgggagcc
gcaggaccccccggccccagtggacctgctggtgaacgaggcgagcagggcgctcctgga
ccatcagggttccagggacttcctggccctcccggtcccccaggtgaaggtggaaagcaa
ggtgaccagggtattcctggtgaagctggagctcctggccttgtgggtcctcggggcgag
cgaggtttcccaggtgaacgtggctctcctggtgctcagggccttcagggtccccgaggc
ctccctggcactcctggtactgatggtcccaaaggtgcagctggcccagatggcccccct
ggggctcaggggcctccaggtctacagggaatgcctggtgagagaggagccgctggcatt
gctgggcccaagggagacagaggcgatgttggcgagaaaggcccagagggagctcctggg
aaggatggcggccgaggtctgactgggcccatcggacccccaggcccagcaggggccaac
ggcgagaagggagaagtcggacctcctggcccgtcaggaagtaccggagctcgaggtgcc
ccgggtgaacgcggagagaccgggccacctggacctgctggattcgctggccctcctggt
gctgatggccagcctggtgccaagggtgatcaaggagaagccggacagaaaggagatgct
ggtgcccccggcccacaaggcccctcgggagcccctgggccacagggtcctactggagtg
actggtcctaagggagcccgaggtgcccaaggtcccccgggagccaccggattccctgga
gctgctggccgagttggacccccaggtgctaatggcaatcctggacccgccggtccccct
ggtcctgctggaaaagatggtcccaaaggtgttcgaggagacagtggcccccctggcaga
gctggtgaccccggtcttcaaggtcctgcaggagctcctggcgagaaaggagaacctgga
gatgatggtccctctggtcttgatggtcctccaggtccccaggggctggctggtcaaagg
ggcattgttggtctgcctggtcagcgtggtgagagaggattccccggccttcccggccca
tcgggtgagcccggcaagcagggtgcacctggcgcgtctggagacagaggtcctcctggt
cctgtggggcctcctggcctgacagggcctgcaggtgaacctggacgagagggcagccct
ggtgctgatggaccccctggaagagatggtgcagctggagtcaagggagatcgtggtgag
actggagcactgggtgcccctggagctcctgggcccccaggctctcctggtcctgctggc
ccaactggcaaacaaggagacagaggagaggctggtgcacaaggtcctatgggtccctca
ggacctgctggagcccgtgggattgcaggccctcaaggcccccgaggtgacaaaggagaa
tctggagagcagggcgagaggggactgaagggacaccgaggtttcactggactgcagggt
ctgcctggccctccgggtccttctggagatcagggtgcttctggccctgctggtccttct
ggccctagaggtccacctggccctgttggtccctctggcaaagatggctctaatggaatc
cctggccccatcgggcctccaggtccccgtggacgctcaggagaaacaggccctgttggt
ccccctggaagtcccggtcctcctggccctccaggtcctcctggtcctggcatcgacatg
tcagcctttgctggcttagggcagagagagaagggccccgaccccatgcagtacatgcgg
gccgacgaggcagacagtaccttgagacagcacgacgtggaggtggacgctacactcaag
tcactgaacaaccagattgagagcatccgcagccccgacggctcccgcaagaaccctgct
cgcacttgccaagacctgaaactctgccaccccgagtggaagagcggagactactggatt
gatcccaaccagggctgcaccttggacgccatgaaagttttctgcaacatggagaccggc
gagacttgcgtctaccccaacccagcgactgtccctcggaaaaactggtggagcagcaag
agcaaggaaaagaaacacatctggtttggagagaccatgaacggtggcttccacttcagc
tatggcgatggcaacctggctcccaacaccgctaacgtccagatgactttcctccgtcta
ctgtccactgagggctcccagaacatcacctaccactgtaagaacagcatcgcctacctg
gacgaagcggctggcaacctcaagaaggccttgctcatccagggctccaatgatgtagag
atgagggccgagggcaacagcaggttcacatacactgccctgaaggatggctgcacgaaa
cacactggtaagtggggcaagaccgtcatcgagtaccgatcacagaagacctcccgcctt
cccattattgacatcgcacccatggacattggaggggctgaacaggaatttggtgtggac
atagggcctgtctgcttcttgtaa

DBGET integrated database retrieval system