KEGG   Mus musculus (mouse): 12825
Entry
12825             CDS       T01002                                 

Symbol
Col3a1, AW550625, Col3, Col3a-1, Tsk, Tsk-, Tsk-2, Tsk2
Name
(RefSeq) collagen, type III, alpha 1
  KO
K19720  collagen type III alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04611  Platelet activation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12825 (Col3a1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12825 (Col3a1)
  09154 Digestive system
   04974 Protein digestion and absorption
    12825 (Col3a1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12825 (Col3a1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12825 (Col3a1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12825 (Col3a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12825 (Col3a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12825 (Col3a1)
SSDB
Motif
Pfam: Collagen COLFI VWC
Other DBs
NCBI-GeneID: 12825
NCBI-ProteinID: NP_034060
MGI: 88453
Ensembl: ENSMUSG00000026043
Vega: OTTMUSG00000021335
UniProt: P08121 Q3TVI5
Position
1 C1.1; 1 23.67 cM
AA seq 1464 aa
MMSFVQSGTWFLLTLLHPTLILAQQSNVDELGCSHLGQSYESRDVWKPEPCQICVCDSGS
VLCDDIICDEEPLDCPNPEIPFGECCAICPQPSTPAPVLPDGHGPQGPKGDPGPPGIPGR
NGDPGLPGQPGLPGPPGSPGICESCPTGGQNYSPQFDSYDVKSGVGGMGGYPGPAGPPGP
PGPPGSSGHPGSPGSPGYQGPPGEPGQAGPAGPPGPPGALGPAGPAGKDGESGRPGRPGE
RGLPGPPGIKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGDNGAPGPMGP
RGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGS
NGSPGQRGEPGPQGHAGAQGPPGPPGNNGSPGGKGEMGPAGIPGAPGLIGARGPPGPAGT
NGIPGTRGPSGEPGKNGAKGEPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLPGA
AGERGPSGFRGPAGPNGIPGEKGPPGERGGPGPAGPRGVAGEPGRDGTPGGPGIRGMPGS
PGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPGG
PGLPGPAGKNGETGPQGPPGPTGPAGDKGDSGPPGPQGLQGIPGTGGPPGENGKPGEPGP
KGEVGAPGAPGGKGDSGAPGERGPPGTAGIPGARGGAGPPGPEGGKGPAGPPGPPGASGS
PGLQGMPGERGGPGSPGPKGEKGEPGGAGADGVPGKDGPRGPAGPIGPPGPAGQPGDKGE
GGSPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPPGP
AGPTGSSGPAGPPGPQGVKGERGSPGGPGTAGFPGGRGLPGPPGNNGNPGPPGPSGAPGK
DGPPGPAGNSGSPGNPGIAGPKGDAGQPGEKGPPGAQGPPGSPGPLGIAGLTGARGLAGP
PGMPGPRGSPGPQGIKGESGKPGASGHNGERGPPGPQGLPGQPGTAGEPGRDGNPGSDGQ
PGRDGSPGGKGDRGENGSPGAPGAPGHPGPPGPVGPSGKSGDRGETGPAGPSGAPGPAGA
RGAPGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGAAGHQGAIGSPGPAGPRGP
VGPHGPPGKDGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGGA
AAIAGVGGEKSGGFSPYYGDDPMDFKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNC
RDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCINASPMTVPRKHWWTDSGAE
KKHVWFGESMNGGFQFSYGPPDLPEDVVDVQLAFLRLLSSRASQNITYHCKNSIAYMDQA
SGNVKKSLKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYQTRKAMRLPII
DIAPYDIGGPDQEFGVDIGPVCFL
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgatgagctttgtgcaaagtggaacctggtttcttctcacccttcttcatcccactctt
attttggcacagcagtccaacgtagatgaattgggatgcagccaccttggtcagtcctat
gagtctagagatgtctggaagccagaaccatgtcaaatatgtgtctgtgactcaggatct
gtcctttgcgatgacataatctgtgatgaggagccactagactgccccaacccagagatc
ccatttggagaatgttgtgcaatatgcccacagccttctacacctgctcctgtgcttcct
gatggccatggacctcaaggccccaagggagatccgggtcctcctggcattcctgggaga
aatggtgaccctggccttccaggacaaccaggtctccctgggcctcctggctcccctgga
atctgtgaatcatgtccaactggtggccaaaattattctccccaattcgactcatatgat
gtcaagtctggagtgggaggaatgggtggctatccgggaccagctggtccaccaggccct
ccaggaccccctggttcttctggacatcctggatctcctggttctcctggataccaaggt
ccccctggtgaacctggtcaagctggtccggcaggccctccaggacctcctggtgctctt
ggtccagctggtcctgctggaaaggatggagagtcaggaagacctggacgacctggagag
cgtggactgcctggacctccaggtatcaaaggcccagctggcatgcctggattccctggt
atgaaaggacacagaggctttgatggacgcaatggagaaaagggagaaacaggtgctcct
ggactgaagggtgaaaatggtcttccaggagacaacggagctcctggccccatgggtcct
agaggggctcctggtgagcgaggacgaccaggccttcctggagctgcaggtgctcgaggc
aatgatggtgctcggggcagtgatgggcaacctggtccccctggccctcctggaactgca
ggattccctggatcccctggtgctaagggtgaagttggacctgcagggtcccctggctca
aatggctcaccaggacaaagaggggagcctggaccgcagggacatgctggtgctcaaggg
cctcctggccctcccgggaataacggcagtcctggtggaaagggtgaaatgggtccagct
ggcattcctggagcccctggactaataggagcaaggggcccccctggaccagcaggaact
aatggtatacccggaacacgaggtccttcaggtgaacccggcaagaacggtgcgaaggga
gagccaggagcacgcggtgaacggggcgaagctggttccccaggaattccaggacctaag
ggcgaagatggcaaagatggatcacctggagaacctggtgcaaatgggcttccaggagcc
gcaggagaaaggggtcctagtggcttccgaggacctgcagggccaaatggcatcccagga
gaaaagggtcctcccggagagcgtggtggcccaggtcctgcaggacccagaggagtagct
ggagaacctggccgagatggaacccctggaggtccagggatacggggtatgcccggaagt
ccaggtggaccaggcaatgatggaaaaccaggacctcctggaagtcaaggagaaagtggt
cgccctggtccccctggcccatctggtcccagaggtcagcctggtgtcatgggtttccct
ggtcctaaaggaaatgatggtgcccctggcaagaatggagaacggggtggccctggagga
cctggccttccaggtcctgctggaaagaatggggagactggacctcagggtcccccagga
cctactggcccagctggtgacaagggagattctggaccccctggtccacaaggattacaa
ggcatacctggtaccggtggtcctccaggagaaaatgggaaaccaggtgaaccaggtcca
aagggtgaagtcggtgctcctggagctcctggaggcaagggtgattctggtgcacctgga
gaacgtgggcctcctggaacagcaggaatccctggtgctagaggtggagctggaccccct
ggccctgagggaggaaagggccctgctggtccccctggccctcctggtgcttctggttct
cctggtctgcaagggatgccaggggaaagaggaggtcctggaagtcctggcccaaagggt
gaaaagggtgaaccaggtggtgcaggtgctgacggagttccaggaaaggatgggccaagg
ggtcctgctggccctattggtccccctggcccagctggtcagcctggagataagggtgaa
ggtggttcccctggacttccaggtatagctggacctcgaggtggccctggtgagagaggt
gaacatggccctccaggacctgctggcttcccgggtgctcctggacagaatggtgaacca
ggtgctaaaggagaaagaggtgcccctggagagaaaggtgaaggaggccctccaggacct
gcaggacccactggcagttctggacctgctggtccgcctggtcctcagggtgtaaagggt
gaacgtggtagtcctggtggtcctggtactgctggctttcccggtgggcgtggtcttcct
ggtcctcctggcaataatggtaatccagggcccccaggacccagtggtgctcctggcaag
gacggccctccaggtcctgcaggcaacagtggttctcctggcaaccctggaatagctgga
ccaaaaggtgatgctggacagcctggagagaaggggccacctggtgctcagggtcctccg
ggttccccaggcccacttggaattgcagggctaactggagcacgaggtcttgctggacca
ccaggcatgccaggtccacggggtagccctggacctcagggtatcaagggtgaaagtgga
aaaccaggagccagtggccataatggggaacgtggtcctcctggaccccaaggtcttcct
ggtcagcctggtacagctggtgaacctggaagggatggaaaccctggatcagatggtcag
ccaggtcgagatggatctcctggtggcaagggtgatcgtggtgaaaatggttctcctggt
gccccaggcgctcctggtcatccaggcccacctggccctgttggtccatctggaaagagt
ggtgacagaggagaaactggccctgctggtccttctggtgctccaggccctgctggagct
cgaggtgctccgggtccccaaggtccacgaggtgacaaaggtgaaactggtgaacgtggc
tctaatggcatcaaaggacatcgaggattccctggcaatccaggtcctccaggttctcct
ggtgctgctggtcaccagggtgcaattggtagtccaggacctgcaggtcccagaggacca
gttggaccacatggacctcctggaaaagatggaacaagtgggcatccaggtcctattgga
ccaccaggtcctagaggaaacagaggtgaaagaggatctgagggctcgccaggccaccct
ggacagccaggaccccctggaccccctggtgcccctggtccctgctgtggtggtggtgct
gctgccattgctggagttggaggtgaaaagtctggtggcttttcaccctattatggagac
gatccaatggatttcaagatcaacactgaagagattatgtcttcactcaagtctgttaat
ggacaaatagagagtcttataagccctgatggttctcgaaaaaaccctgctcggaactgc
agagacctaaaattctgccaccccgaactcaagagtggagaatactgggttgatcctaac
caaggctgcaagatggatgctataaaagtattctgtaacatggaaactggggaaacatgc
ataaatgccagccccatgactgtcccacgtaagcactggtggacagattctggtgcagag
aagaaacatgtttggtttggagaatctatgaatggtggttttcagttcagctatggccct
cctgatcttcctgaagatgtcgttgatgtgcagctggcattcctcagacttctttccagc
cgggcctcccagaacattacataccactgcaaaaacagtattgcctatatggatcaggcc
agtggcaatgtaaagaagtctctgaagctgatgggatcaaatgaaggcgaattcaaggct
gaaggaaacagcaaattcacttacacagttctagaggatggctgtactaaacacactggg
gaatggagcaagacagtctttgaatatcaaacacgcaaggcaatgagactacccatcata
gatatcgcaccctatgacattgggggtcctgatcaagaatttggtgtggacattggccct
gtttgctttttataa

DBGET integrated database retrieval system