KEGG   Mus musculus (mouse): 12829Help
Entry
12829             CDS       T01002                                 

Gene name
Col4a4, E130010M05Rik, [a]4(IV)
Definition
(RefSeq) collagen, type IV, alpha 4
  KO
K06237  collagen, type IV, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12829 (Col4a4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12829 (Col4a4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12829 (Col4a4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12829 (Col4a4)
  09154 Digestive system
   04974 Protein digestion and absorption
    12829 (Col4a4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12829 (Col4a4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    12829 (Col4a4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12829 (Col4a4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12829 (Col4a4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12829 (Col4a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12829 (Col4a4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12829 (Col4a4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12829 (Col4a4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12829 (Col4a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C4
Motif
Other DBs
NCBI-GeneID: 12829
NCBI-ProteinID: NP_031761
MGI: 104687
Ensembl: ENSMUSG00000067158
Vega: OTTMUSG00000021695
UniProt: Q9QZR9
Position
1; 1 C5
AA seq 1682 aa AA seqDB search
MRCFFRWTKSFVTAPWSLIFILFTIQYEYGSGKKYGGPCGGRNCSVCQCFPEKGSRGHPG
PLGPQGPIGPLGPLGPIGIPGEKGERGDSGSPGPPGEKGDKGPTGVPGFPGVDGVPGHPG
PPGPRGKPGVDGYNGSRGDPGYPGERGAPGPGGPPGQPGENGEKGRSVYITGGVKGIQGD
RGDPGPPGLPGSRGAQGSPGPMGHAGAPGLAGPIGHPGSPGLKGNPATGLKGQRGEPGEV
GQRGPPGPTLLVQPPDLSIYKGEKGVKGMPGMIGPPGPPGRKGAPGVGIKGEKGIPGFPG
PRGEPGSHGPPGFPGFKGIQGAAGEPGLFGFLGPKGDLGDRGYPGPPGILLTPAPPLKGV
PGDPGPPGYYGEIGDVGLPGPPGPPGRPGETCPGMMGPPGPPGVPGPPGFPGEAGVPGRL
DCAPGKPGKPGLPGLPGAPGPEGPPGSDVIYCRPGCPGPMGEKGKVGPPGRRGAKGAKGN
KGLCTCPPGPMGPPGPPGPPGRQGSKGDLGLPGWHGEKGDPGQPGAEGPPGPPGRPGAMG
PPGHKGEKGDMVISRVKGQKGERGLDGPPGFPGPHGQDGGDGRPGERGDPGPRGDHKDAA
PGERGLPGLPGPPGRTGPEGPPGLGFPGPPGQRGLPGEPGRPGTRGFDGTKGQKGDSILC
NVSYPGKPGLPGLDGPPGLKGFPGPPGAPGMRCPDGQKGQRGKPGMSGIPGPPGFRGDMG
DPGIKGEKGTSPIGPPGPPGSPGKDGQKGIPGDPAFGDPGPPGERGLPGAPGMKGQKGHP
GCPGAGGPPGIPGSPGLKGPKGREGSRGFPGIPGSPGHSCERGAPGIPGQPGLPGTPGDP
GAPGWKGQPGDMGPSGPAGMKGLPGLPGLPGADGLRGPPGIPGPNGEDGLPGLPGLKGLP
GLPGFPGFPGERGKPGPDGEPGRKGEVGEKGWPGLKGDLGERGAKGDRGLPGDAGEAVTS
RKGEPGDAGPPGDGGFSGERGDKGSSGMRGGRGDPGRDGLPGLHRGQPGIDGPPGPPGPP
GPPGSPGLRGVIGFPGFPGDQGDPGSPGPPGFPGDDGARGPKGYKGDPASQCGPPGPKGE
PGSPGYQGRTGVPGEKGFPGDEGPRGPPGRPGQPGSFGPPGCPGDPGMPGLKGHPGEVGD
PGPRGDAGDFGRPGPAGVKGPLGSPGLNGLHGLKGEKGTKGASGLLEMGPPGPMGMPGQK
GEKGDPGSPGISPPGLPGEKGFPGPPGRPGPPGPAGAPGRAAKGDIPDPGPPGDRGPPGP
DGPRGVPGPPGSPGNVDLLKGDPGDCGLPGPPGSRGPPGPPGCQGPPGCDGKDGQKGPMG
LPGLPGPPGLPGAPGEKGLPGPPGRKGPVGPPGCRGEPGPPADVDSCPRIPGLPGVPGPR
GPEGAMGEPGRRGLPGPGCKGEPGPDGRRGQDGIPGSPGPPGRKGDTGEAGCPGAPGPPG
PTGDPGPKGFGPGSLSGFLLVLHSQTDQEPACPVGMPRLWTGYSLLYMEGQEKAHNQDLG
LAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLSSAAPLPMMPLSEEEIRSYISRCAV
CEAPAQAVAVHSQDQSIPPCPRTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRA
APFVECQGRQGTCHFFANEYSFWLTTVNPDLQFASGPSPDTLKEVQAQRRKISRCQVCMK
HS
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgctttttcagatggaccaagtcctttgtcacagccccctggtcactaatattt
atcctctttactatacaatatgaatatgggagtggcaagaagtatggcggcccctgcgga
ggaagaaactgctctgtctgccagtgttttcctgagaagggatctcggggtcacccagga
ccactgggaccacagggaccaatagggcccttgggacccctgggacctattgggattcca
ggagaaaaaggagagagaggagacagtggctcacctggaccaccaggagagaaaggagac
aagggtccaactggtgtccctggatttccaggtgtggatggtgtacctggtcacccaggg
cctcctggacccagaggcaaacctggtgtggacggctacaatggctcacgtggtgatccg
ggctatccaggagaaagaggagctccaggcccaggcggcccccctggtcagcctggggaa
aatggagaaaaaggaagatctgtgtacattactggtggcgttaaaggtattcagggagac
cgtggggacccaggaccacccggcttaccaggatctaggggtgcacaagggtcaccaggg
cccatggggcatgcaggcgcaccagggctagcaggacctataggtcatcctggaagccct
gggttgaagggaaatcctgccactggactgaagggacaaaggggagagccgggtgaagtt
ggccagcgtggtcctcctgggcccacgctgttggtacagccgcctgatttgagtatctat
aaaggagaaaagggtgtaaaaggaatgcctggaatgattggtcccccaggacctccaggt
cgcaagggagcgcctggtgtcgggatcaaaggagagaaaggtatccctgggttcccagga
ccccggggtgagcctggttcgcatgggcctccaggttttccaggattcaaggggatacaa
ggagcagctggagagcctgggctgttcggatttcttggtccaaagggggatctgggagat
cgcgggtacccgggaccaccaggcattttgttgactccagctccaccactcaaaggtgtt
ccaggggacccaggaccccctggctactatggggagattggagatgttggattaccaggt
cctccagggcccccaggcagaccaggggaaacttgtccaggcatgatgggacctcctgga
ccaccaggggttcctggtcctccaggatttccaggagaagctggggttcctggaagactc
gactgtgccccaggaaaacctgggaagccagggctacccggcctgcctggcgcaccagga
ccagaggggccccctggatcagatgtgatatactgtcgccctgggtgccctgggccaatg
ggtgaaaagggaaaagtgggtcctccaggaagaagaggagccaaaggagcaaaaggaaac
aagggactctgtacctgtccacctggtcccatgggaccccctggtcccccaggacctcct
ggaagacaaggaagtaaaggagacttagggctccctggttggcatggagaaaagggcgat
ccaggtcagcctggtgctgaaggaccgccagggccaccaggaagacctggtgccatgggg
ccccctggtcacaaaggggaaaagggtgacatggtcatatcaagagtgaaagggcaaaaa
ggagaaagaggactggatgggccaccaggatttccggggccacatggacaagatggtggg
gatggacgtcctggagaaagaggggatcctgggccacgaggggaccataaggatgcagcc
ccgggtgagagagggcttcccggactgccaggccctccaggaagaacaggacctgagggg
cctccaggcctgggatttccaggcccaccaggacagcgaggcctacccggagagcccggg
cgtccgggcaccagaggctttgatggcacgaaggggcagaaaggtgactccattctgtgt
aatgtaagctacccgggaaaaccaggtctgccaggtcttgatggacctccaggtctgaag
gggtttccaggccccccaggggctcctggtatgagatgtccagatgggcagaaaggccag
cggggcaaaccgggaatgtctgggattccaggtccacctggttttcgtggtgacatggga
gatccaggcatcaaaggtgaaaaggggacctcccctattggacccccaggcccacctggg
tctcctggaaaggatggccagaaaggaatcccaggagaccctgcatttggtgacccagga
ccccctggagagaggggtcttccaggagcaccaggcatgaaaggacagaaaggtcaccca
gggtgcccaggggctggaggccctcctggcatccctggatctccaggtctcaaaggtccc
aaaggtagagagggaagtcgtggctttccagggatcccaggatcccctggccattcctgt
gaaagaggtgctcccgggatcccaggacaaccgggacttcctggaactccaggtgatcca
ggggccccaggttggaaaggccagccaggagacatgggtccctctggaccagctgggatg
aagggcctccctggtctcccaggcctaccaggagctgatggtctccgagggcctcctggg
attccaggccccaatggggaagatggtctacctggtcttccaggcctgaagggactccca
gggctgcctggcttccctggttttccaggagagagaggaaagccagggccagatggagaa
cctggaagaaagggagaggttggagagaaaggctggcctggcttgaagggagacctggga
gagcgaggcgccaaaggagacagaggacttcctggtgatgcaggagaagcagtcacttcc
agaaagggtgaacctggggatgctgggcctccaggagatggtgggttctcaggagagaga
ggtgataaaggaagctcagggatgcgagggggaagaggggatcccggaagagatggacta
ccgggactccacagagggcagcctgggatagatgggcctcctgggcctcctgggccccct
ggccctccaggatcacctggactgagaggagtcattggtttcccaggatttccaggtgac
cagggtgatccaggttctccaggaccccctggattcccaggagatgatggagcaagagga
cctaaaggatacaaaggtgaccctgccagtcagtgtggtccacctggtccaaagggtgag
ccaggtagtcctggataccaaggacgtactggagtccccggagagaaaggctttcctgga
gatgaaggaccccgaggaccaccaggcagacctggacagcctggatcttttggaccacca
gggtgtccaggtgacccagggatgcccggactcaagggacatccaggagaagtgggagac
cctgggccaagaggtgatgcgggagatttcgggaggccaggtcctgctggagtgaaaggg
cctctcgggtctcctggtctgaatggcttacatggtctgaagggtgagaaaggaacaaaa
ggcgcctcaggtttgctcgaaatgggtccacctgggccaatggggatgcctgggcaaaaa
ggagagaaaggagaccctgggagtccagggatttctcctccaggtcttcctggagaaaag
ggcttcccaggacccccagggagaccaggaccacctggtcccgcaggtgccccaggaaga
gctgctaaaggtgacattcctgatccaggtccacctggagaccggggacctcctggcccc
gatggcccaagaggagtacctgggcctccgggttcccctgggaatgttgaccttctgaaa
ggggacccaggtgactgtggtttgccaggaccacctggctcccgaggcccaccaggccct
ccagggtgtcagggtcccccaggatgtgatggcaaagatggccagaaaggaccaatggga
cttccagggttgccagggccacctggtcttcctggggcacctggcgagaagggattacct
ggccctccaggcagaaaagggccagtaggtcctccaggctgcagaggtgaacctgggcct
cctgcagacgtggattcctgtcctcgaatcccaggacttcctggagtgccaggtcccaga
ggaccagaaggagctatgggggaacctggacggagaggcctgcctggaccagggtgcaaa
ggagagcctggaccggatggcagacggggccaggatggcatccctggatctcccgggcct
cctggacgcaaaggtgacactggagaggcagggtgtcctggagcaccaggccctcctggt
ccaactggtgatcctgggcccaaggggtttggccctggatcgctcagtggcttcctcctg
gttctccacagtcagactgaccaggaaccggcctgccccgtgggcatgcctcggctttgg
acagggtacagcttgttgtacatggaaggacaggagaaggcgcacaatcaagatcttggt
ttggcaggctcttgtcttcctgtgtttagcactctgccctttgcctactgcaacatccac
caagtgtgccactacgcccagagaaatgacaggtcctactggctgtccagtgcggctcct
cttcctatgatgccactctcagaggaagagatccgctcttacatcagccgctgtgcggtg
tgtgaggccccagcacaggccgtggcggtccacagtcaggaccaatccatcccaccgtgt
ccacggacatggaggagtctctggattgggtactcatttctgatgcacactggagctggg
gaccaaggaggtgggcaggcactgatgtcacctggcagctgcctagaggacttcagagct
gcaccgttcgttgaatgccagggccgacagggaacctgtcacttttttgcaaacgagtac
agcttctggctgaccaccgtgaacccagacctgcagtttgcctctggcccgtcaccagac
accttgaaagaagttcaggcccagcgccggaaaatcagcaggtgccaggtttgcatgaag
cacagctaa

DBGET integrated database retrieval system