KEGG   Mus musculus (mouse): 12831Help
Entry
12831             CDS       T01002                                 

Gene name
Col5a1, AI413331
Definition
(RefSeq) collagen, type V, alpha 1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12831 (Col5a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12831 (Col5a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12831 (Col5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 12831
NCBI-ProteinID: NP_056549
MGI: 88457
Ensembl: ENSMUSG00000026837
Vega: OTTMUSG00000011567
UniProt: O88207 B1AWB9
Position
2 A3; 2 19.38 cM
AA seq 1838 aa AA seqDB search
MDVHTRWKAARPGALLLSSPLLLFLLLLWAPPSSRAAQPADLLEMLDFHNLPSGVTKTTG
FCATRRSSSEPDVAYRVSKDAQLSMPTKQLYPESGFPEDFSILTTVKAKKGSQAFLVSIY
NEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDGKWHRIALSVYKKNVTLI
LDCKKKITKFLSRSDHPIIDTNGIVMFGSRILDDEIFEGDIQQLLFVSDNRAAYDYCEHY
SPDCDTAVPDTPQSQDPNPDEYYPEGEGETYYYEYPYYEDPEDPGKEPAPTQKPVEAARE
TTEVPEEQTQPLPEAPTVPETSDTADKEDSLGIGDYDYVPPDDYYTPPPYEDFGYGEGVE
NPDQPTNPDSGAEVPTSTTVTSNTSNPAPGEGKDDLGGEFTEETIKNLEENYYDPYFDPD
SDSSVSPSEIGPGMPANQDTIFEGIGGPRGEKGQKGEPAIIEPGMLIEGPPGPEGPAGLP
GPPGTTGPTGQMGDPGERGPPGRPGLPGADGLPGPPGTMLMLPFRFGGGGDAGSKGPMVS
AQESQAQAILQQARLALRGPAGPMGLTGRPGPMGPPGSGGLKGEPGDMGPQGPRGVQGPP
GPTGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGDPGPSGPPGIPGDD
GERGDDGEVGPRGLPGEPGPRGLLGPKGPPGPPGPPGVTGMDGQPGPKGNVGPQGEPGPP
GQQGNPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPP
GPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGED
GPEGPKGRGGPNGDPGPLGPTGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGR
GTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKGNSGGDGPAGPPGERGPNGPQGPTGFP
GPKGPPGPPGKDGLPGHPGQRGETGFQGKTGPPGPPGVVGPQGPTGETGPMGERGHPGPP
GPPGEQGLPGAAGKEGTKGDPGPAGLPGKDGPPGLRGFPGDRGLPGPVGALGLKGSEGPP
GPPGPAGSPGERGPAGAAGPIGIPGRPGPQGPPGPAGEKGLPGEKGPQGPAGRDGLQGPV
GLPGPAGPVGPPGEDGDKGEIGEPGQKGSKGDKGEQGPPGPTGPQGPIGQPGPSGADGEP
GPRGQQGLFGQKGDEGSRGFPGPPGPVGLQGLPGPPGEKGETGDVGQMGPPGPPGPRGPS
GAPGADGPQGPPGGIGNPGAVGEKGEPGEAGDPGLPGEGGPLGPKGERGEKGEAGPSGAA
GPPGPKGPPGDDGPKGSPGPVGFPGDPGPPGEPGPAGQDGPPGDKGDDGEPGQTGSPGPT
GEPGPSGPPGKRGPPGPAGPEGRQGEKGAKGEAGLEGPPGKTGPIGPQGAPGKPGPDGLR
GIPGPVGEQGLPGSPGPDGPPGPMGPPGLPGLKGDSGPKGEKGHPGLIGLIGPPGEQGEK
GDRGLPGPQGSSGPKGDQGITGPSGPLGPPGPPGLPGPPGPKGAKGSSGPTGPKGEAGHP
GLPGPPGPPGEVIQPLPIQASRTRRNIDASQLLDDGAGESYVDYADGMEEIFGSLNSLKL
EIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGGSTC
VFPDKKSEGARITSWPKENPGSWFSEFKRGKLLSYVDAEGNPVGVVQMTFLRLLSASAHQ
NVTYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRALVDGCATKKGYQKTVL
EIDTPKVEQVPIVDIMFNDFGEASQKFGFEVGPACFLG
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacacacccgctggaaagctgcgcgcccaggcgccctgctgctgtcttcgccg
ctactcctgttcctgctgctgctgtgggcgccgccttcgagccgcgcagctcagccagca
gatcttctggagatgctagattttcacaatttgccctcaggggtaacgaaaaccacaggt
ttctgtgctactcgaagatcttccagcgagccggatgttgcctaccgagtctctaaagat
gcacagctcagcatgcccaccaagcagctgtaccctgagtctggttttcccgaggacttc
tccatcctgacaaccgtgaaagccaagaaaggcagccaggccttcctagtctccatttac
aatgagcagggcatccagcagttggggctggagctgggccgctcccctgtcttcctctat
gaggaccacacagggaagcccgggcctgaagagtatccgcttttccctggcatcaacttg
tccgatggcaagtggcaccgaattgctctcagtgtctacaagaaaaatgtcaccttgatc
ctcgactgtaagaagaagattacgaagttcctcagccgcagtgaccaccccataatagac
accaatgggattgtcatgtttggctcccggattctggatgatgaaatatttgagggtgac
atccaacagttgcttttcgtctctgacaaccgagctgcctatgactactgtgagcactac
agccccgactgtgacactgcggtccctgacacacctcagtcacaggaccctaacccggat
gaatattacccagaaggagagggtgagacctattactatgagtatccatattatgaagac
cctgaagacccgggaaaggagcctgcccctactcagaagccagtggaagctgccagagaa
accacagaggttcctgaggagcagacccagcccctacccgaagcccctacagtgcctgag
accagtgacacggctgacaaggaggacagtctagggatcggggactatgactacgtgccc
ccagatgactattacactccacccccatatgaagactttggatatggcgagggtgtggag
aaccctgaccagcccaccaaccccgactcaggggctgaggtccccaccagcaccactgtt
acctccaacacctccaatccagctccaggagaagggaaggatgacctgggcggcgaattc
accgaggaaaccatcaagaatctagaggaaaactactatgacccgtactttgaccccgac
tccgactccagtgtctctccatcagagatagggccaggcatgcccgctaaccaggacacc
atctttgaggggattggaggaccccgaggtgagaaagggcaaaagggagaaccagccatc
attgagccggggatgctgatcgaggggccccctggccctgaaggccctgctggtcttcca
ggacctccaggaactacaggtcctactggccaaatgggtgaccctggagaaaggggtccc
cctgggcgcccaggtcttcctggagctgatggcttgcctggccccccaggtaccatgctc
atgctgccgttccggtttggaggcggtggcgatgccggttctaagggccccatggtctct
gcgcaggagtcccaggcccaggctatcctccagcaagccaggttggcactgaggggacca
gctggcccaatgggtctcaccgggagacctggccccatgggtcctcctgggagtggcggt
ttgaaaggtgagccaggagacatgggacctcagggtcctcgaggtgtgcaaggcccacct
ggcccaacagggaagcctggaagacggggccgtgctggaagtgatggagccagaggcatg
cctggacaaacaggccccaagggtgaccgtggctttgatggtctggctgggttgccggga
gagaaaggccatagaggtgaccctggtccttctggcccgcccggaatcccaggagatgat
ggagaaaggggtgacgatggagaagttgggcccaggggactgcccggggagcctggacca
cgtggtctgcttgggccaaaaggccccccagggcctcctggacctcctggtgtaacgggt
atggatggccagcctggcccaaaaggaaatgtgggtccccagggagagcctgggccgcca
ggacagcagggtaatcctggtgcccagggtcttccaggtccccagggtgccattggtcct
ccaggagaaaagggtcctttggggaaaccaggtctcccaggaatgccaggcgctgatgga
cccccggggcaccctggaaaagaaggtcctccaggagagaaaggaggccagggtcctcct
ggcccccagggtcccattggctaccccggtccacgaggagtcaagggggcagatggcatc
cgaggtctgaagggcaccaagggggagaagggtgaagacggcttccctgggtttaaaggc
gacatgggaataaagggtgaccggggggaaatcggcccacctggtccccgaggagaagat
ggtcctgaaggtccaaagggtcgaggtggtcccaatggtgatcctggtcccctggggccc
actggggaaaagggaaagcttggcgtgcccggattaccggggtacccaggaagacaaggg
ccaaagggttccattggattccctggcttcccgggcgccaacggagagaagggtggcagg
gggacacctggaaagccaggaccacggggacagagaggcccaacgggcccgcggggtgaa
cgaggcccacgaggcatcacggggaagcctggccctaagggcaactccggaggtgatggc
ccagctggccctcctggtgaacggggacccaacggaccccaaggtcccaccggctttcct
ggacccaagggtcccccgggcccaccaggcaaggacggactccctggacaccctgggcag
agaggggagaccggtttccaaggcaagactggccctccagggcccccaggagtggttggc
cctcagggtcccacaggagagacgggccccatgggtgagcgtggccatcctggtcctcca
ggccctcctggtgaacagggcctcccaggtgctgctgggaaagaaggaacgaagggtgac
ccaggtcctgctggcctccctgggaaggatggccctccaggattgcgtggattccctggg
gaccgagggctacctggccccgtgggagcccttggactcaaaggcagtgaaggcccccct
ggcccaccaggtcctgcgggttctccaggggagagaggaccagctggtgccgctgggccc
atcggaattccagggagacctgggcctcagggacctccggggcctgctggagagaaagga
cttcctggcgagaaaggtccacaaggcccagctggccgagatggcctccaaggtcccgtg
gggctccctggaccagccggcccagtgggtcctcctggagaagatggagataagggagag
atcggagagccagggcagaagggaagcaagggcgacaaaggcgagcagggtcctcctggg
cctaccggtcctcaaggcccgattggacagccaggcccttcgggagcagatggtgaacct
ggccctcgtggacagcagggcctgtttgggcagaaaggagatgaaggttcaagaggtttc
ccaggaccccccgggccagtgggattgcagggtttgccaggacctccaggagaaaagggc
gagacaggagacgtgggccagatgggccctcctggtccaccaggcccccgaggaccctct
ggagctccaggtgccgatggaccacagggtcctcctggagggattggcaaccctggtgca
gtcggagaaaagggagaacctggtgaagctggagatcctggccttccaggagaaggaggt
cccctgggacctaaaggagaaagaggggagaagggagaggctggcccctctggtgctgct
ggaccccctggacccaaaggccctcctggagatgatggccccaaaggcagccctggccct
gtgggctttcctggagatcctggtccccctggagagccaggccccgcaggtcaagacggc
ccacctggtgacaaaggggacgatggtgaacctgggcagacggggtccccgggccctact
ggtgaacctggtccatctgggcctccaggaaagaggggtcccccaggccctgcaggccct
gaaggcaggcagggggagaaaggagccaagggagaagctggcttagaaggccctcctggg
aagactggccccattggcccccaaggggcccctgggaagcctggccccgatggtctccgt
ggaatccctggtcctgtgggtgagcaaggcctcccaggatccccaggccccgatggtcca
cccggccccatgggtcctccaggactccctggcctcaaaggagactccggtcccaaaggt
gaaaagggccatccaggcctgattggactcatcggccctccgggagagcaaggtgaaaag
ggtgaccgtggactcccaggcccccagggttcatctggtcctaaaggagatcagggcatc
acaggtccttctggcccacttgggcctcctggtcctcctggcttgccgggccctccaggt
cccaaaggtgctaagggctcttcgggtcccaccggcccgaagggtgaggcaggccaccca
ggactccccggcccacctggccctccgggtgaggtcatccagcccctgccaatccaggcc
tccaggactcggcggaacattgatgccagccagctcctggacgatggggctggggagagc
tacgtggattatgcagatggcatggaagagatctttggttccctcaactccctgaagctg
gagattgaacagatgaagcgaccactgggcacccagcagaacccagcccgtacctgcaag
gatctacagctctgtcatcctgacttcccagatggcgaatactgggtcgatcccaaccaa
gggtgctccagggactccttcaaagtctactgcaatttcacagctggagggtccacgtgc
gtcttccctgacaagaagtctgagggagccagaatcacttcttggcccaaagaaaaccca
ggttcctggttcagtgaattcaagcgtgggaaactgctctcctatgtggatgctgaaggc
aaccccgtgggcgtggtacaaatgaccttcctgcggctgctgagcgcctctgcccaccag
aacgtcacctacaactgctaccagtccgtggcctggcaggatgccgccacaggcagctat
gataaggctatccgcttcttgggctccaacgatgaggaaatgtcttatgataacaacccc
tacatccgtgccctggtggatggctgtgctaccaagaaaggctaccagaagacggtgctg
gagatcgacacgcccaaagtagagcaagtccccattgtggacatcatgttcaacgacttt
ggcgaagcctcacagaaatttggatttgaagtggggccagcttgcttcctaggctag

DBGET integrated database retrieval system