KEGG   Mus musculus (mouse): 12832Help
Entry
12832             CDS       T01002                                 

Gene name
Col5a2, 1110014L14Rik
Definition
(RefSeq) collagen, type V, alpha 2
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12832 (Col5a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12832 (Col5a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12832 (Col5a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI VWC TILa Amnionless
Motif
Other DBs
NCBI-GeneID: 12832
NCBI-ProteinID: NP_031763
MGI: 88458
Ensembl: ENSMUSG00000026042
Vega: OTTMUSG00000021356
UniProt: Q3U962
Position
1; 1 C1.1
AA seq 1497 aa AA seqDB search
MMANWVGARPLLILSVLLGYCVSIKAQEQENDEYDEEIACTQHGQMYLNRDIWKPSPCQI
CVCDNGAILCDKIECPEVLNCANPITPTGECCPVCPQTGGGDTSFGRGRKGQKGEPGLVP
VVTGIRGRPGPAGPPGSQGPRGDRGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPSHP
GPDGMSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGVGPAGPPGEP
GEPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNTGEVGFSGSPGARGFPGAPGLPGLKGHR
GHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMP
GKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAV
GTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPK
GEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQ
GERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPP
GSIGIRGQPGSMGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPGLA
GERGEQGPPGPTGFQGLPGPPGPPGEGGKAGDQGVPGEPGAVGPLGPRGERGNPGERGEP
GITGLPGEKGMAGGHGPDGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGI
GEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENGPT
GAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPHGVPGLKGGRGTQ
GPPGATGFPGSAGRVGPPGPAGAPGPAGPAGEPGKEGPPGLRGDPGSHGRVGDRGPAGPP
GSPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVGPT
GATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQ
GAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQK
GHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPGVR
GSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDENMPDPLPEFTEDQAAPDDTN
KTDPGIHVTLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAED
AIKVYCNMETGETCISANPASVPRKTWWASKSPDNKPVWYGLDMNRGSQFTYGDYQSPNT
AITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSNDLEIKGEGNIRFR
YTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNADQEFGLDIGPVCFM
NT seq 4494 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaactgggtgggagcaagacctctcctcattctttctgttttattagggtac
tgtgtctcaataaaagcccaggaacaagagaatgatgaatatgatgaagaaatagcctgt
actcaacatggacagatgtatttaaatagagacatttggaaaccttctccatgtcagatc
tgtgtctgtgacaatggtgccattctttgtgacaagatagagtgcccagaggtgctcaac
tgtgccaatcctataacacccactggggagtgctgtccggtgtgcccacaaactggaggt
ggagatactagttttggtagaggaagaaagggacaaaaaggagaaccaggattagtgcct
gttgtaacaggtatacgcggtcgtccaggacctgcaggccccccaggatcacaaggacca
agaggggaccgaggccctaaaggaagacctggtcctcgtggtcctcagggaattgatgga
gagccaggtgtgcctggtcagccaggtgctccagggcctcctgggcacccctctcaccca
ggacctgatggcatgagcaggcctttttcagctcagatggctgggctggatgaaaaatct
ggacttggaagtcaagtaggactcatgcctggctctgtgggtcctgttggcccaagagga
cctcagggtttacaaggacagcaaggtggtgtgggacccgcaggacctcctggtgagcct
ggcgagcctggaccaatgggtccaattggttctcgtggaccagagggcccacctgggaag
cccggagaagatggtgaacctggaagaaatgggaatacaggtgaagtgggattctcagga
tcaccaggtgctcgaggcttccctggtgctcctggtctccctggcttgaaaggtcacaga
ggacacaaaggtcttgaaggccccaaaggtgaaattggagcacctggtgctaagggtgaa
gctggccccactggtccaatgggtgctatgggccctctgggaccaagaggaatgccagga
gagaggggaagacttgggccacagggtgctcctggaaaacggggtgcccacggtatgcct
ggaaaacctggaccaatgggtcctcttgggatacctggctcttccggttttccaggaaat
cctggaatgaagggagaagcaggtcctactggagcccgaggccctgaaggtcctcagggg
cagagaggtgaaactgggccacctggtccagctggctctcagggtcttcctggtgcagtg
gggactgatggtacacctggcgccaaaggccccacaggctctgcaggaacctctggccct
cctggcttggcagggccccctgggtctcctggccctcaaggcagtactggacctcaggga
atccgaggacaatcgggtgatccaggagttccaggtttcaaaggagaagctggtccaaag
ggagaaccagggccacatggtattcagggtcccattggtccacctggtgaagaaggcaaa
agaggtcctcggggtgatccaggcacagttggtcctccaggaccaatgggagaaaggggc
gctcctggcaatcgtggttttccagggtctgatggtttacctggaccaaagggtgctcag
ggagagcgtggtcctgtaggttcttcggggcctaaaggaggccagggagatccaggacgt
ccaggagaacctgggcttccaggtgctcggggtctgacaggaaatcctggtgttcaaggt
cctgaaggaaaacttgggcctttgggtgctcctggggaagatggtcggccaggtcctcca
ggctccattgggatcagaggacagcctggaagcatgggccttccaggccccaaaggtagc
agtggtgaccttggaaaaccaggagaagcaggaaatgctggtgtgcctgggcaaaggggg
gctcctggcaaagatggagaagttggtccttcaggccctgtgggacctccgggcctagct
ggggaaagaggagagcagggacctccaggccccactggctttcagggacttcctggacct
ccagggccacctggagaaggtggaaaggctggtgatcaaggtgttcctggagagcctgga
gcagttggcccattaggacctcggggagaaagagggaatcctggagaaagaggagagcca
gggataactggactgcctggggagaaaggcatggctggaggacatggccctgatggtcca
aagggcaacccaggtccaactgggaccattggagacacagggccaccaggtcttcagggc
atgccaggagaaagaggaattgcaggaacacctggccctaagggtgaccgaggtggcata
ggagagaaaggtgctgaaggaacagcaggaaatgacggggcaaggggtcttccaggtccc
ttgggacctccaggtcctgcaggccctactggagaaaagggtgaacctggtcctagaggc
ttagttggccctcctggctcccgtggcaatcctggttctcgtggtgaaaatggtccaact
ggagctgttggttttgctggaccccagggtcccgatggacagcctggtgtcaagggtgag
cctggagagccaggacagaagggagatgctgggtctcctggaccccaagggctagcagga
tcacctggcccccatggtccacatggtgttcctggactgaaaggcggtagaggaacccag
ggtccacctggtgctacagggtttcctggttctgctggcagagttgggcctccaggccct
gctggagctccaggacctgcagggcccgcaggagaacctgggaaggaaggacctcctggt
cttcgtggtgaccctggctctcatgggcgagtgggagatagaggaccagctggcccacct
ggtagcccaggagataaaggggacccaggagaagatggacaacctggtccagatggtcct
cctggtcccgctggtaccactgggcaaagaggaattgttggaatgcccggacaacgtggg
gaacgaggaatgcctggccttcctggcccagcgggtacaccaggaaaagtaggaccaact
ggtgcgacaggagataaaggtccccctggacctgtaggacctccaggttccaatggtcct
gtaggagaacctgggccagaaggtccggctggtaatgatggtaccccaggacgggatggt
gctgttggagaacggggtgaccgtggagaccccgggcctgctggtctaccaggctctcag
ggtgcccctggaactcctggccctgttggtgcccctggagatgcaggacaaagaggagag
ccaggttctcgaggccctgtaggaccacctggtcgagctggaaagcgtggtttacctgga
ccacaaggacctcgaggtgacaagggtgacaatggagacagaggtgaccgaggtcagaaa
ggccacagagggttcactggcctgcagggtcttcctggacctcctggtccaaatggtgaa
caaggaagtgctggcattcctggtcctttcggtccaagaggtcctccaggaccagtaggt
ccttcaggaaaggaaggaaaccctgggccacttggaccaattggacctcctggtgtgcgg
ggcagtgtaggagaagcaggaccagagggtcctcctggtgaacctgggcctcctggccct
ccaggtccccctggccatcttactgctgctcttggtgatatcatgggacactatgatgag
aacatgccagatccacttccagagtttacggaagaccaggcagctccagatgacacaaac
aaaacagaccctgggatccatgttaccctgaagtctctcagtagtcagattgaaaccatg
cgtagccctgatggttccaagaaacacccagcccgcacttgtgatgatttaaagctttgc
catcccacaaagcagagcggtgaatattggattgatcctaaccagggatcagctgaagat
gcaatcaaagtttactgcaatatggaaacaggagagacatgtatttcagcaaacccagcc
agtgttccacgtaaaacctggtgggccagcaaatcccctgacaataagcctgtgtggtac
ggtcttgacatgaatagaggatctcagttcacatatggagattaccagtctcctaacaca
gctatcactcagatgacctttttgcgtcttttatcaaaagaagcctcgcagaaccttact
tacatctgtaggaacactgttggatatatggatgatcaagctaaaaacctcaagaaagct
gtggtccttaaagggtcaaacgacttagaaataaaaggagaaggaaacatcagattcaga
tacacagttcttcaagacacctgctctaagcgaaatggaaatgtaggcaaaactatcttt
gaatacagaacacagaatgtggcccgcttgcccatcatagatgttggtcctgtggatatt
ggcaatgcagaccaggaatttggccttgatattgggccagtttgtttcatgtaa

DBGET integrated database retrieval system