KEGG   Mus musculus (mouse): 12833
Entry
12833             CDS       T01002                                 

Gene name
Col6a1, AI747156, Col6, Col6a-1
Definition
(RefSeq) collagen, type VI, alpha 1
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12833 (Col6a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12833 (Col6a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12833 (Col6a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12833 (Col6a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12833 (Col6a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12833 (Col6a1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12833 (Col6a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12833 (Col6a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12833 (Col6a1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12833 (Col6a1)
Motif
Pfam: VWA Collagen VWA_2 VWA_3 YcaO Toprim_3 ETF
Other DBs
NCBI-GeneID: 12833
NCBI-ProteinID: NP_034063
MGI: 88459
Ensembl: ENSMUSG00000001119
Vega: OTTMUSG00000020489
UniProt: Q04857 B0LAD9
Position
10 C1; 10 39.71 cM
AA seq 1025 aa
MRLAHALLPLLLQACWVATQDIQGSKAIAFQDCPVDLFFVLDTSESVALRLKPYGALVDK
VKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKASVDAVK
YFGKGTYTDCAIKKGLEELLIGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKH
LGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGHSRDAEEVISQTIDTIVDMIKN
NVEQVCCSFECQAARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGMK
GEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGMKGETGYPGLPGCKGSPGFDGIQGPPGPK
GDAGAFGMKGEKGEAGADGEAGRPGNSGSPGDEGDPGEPGPPGEKGEAGDEGNAGPDGAP
GERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDSGEAGPIGPKGYRGDE
GPPGPEGLRGAPGPVGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGNRGPPGLNGTKG
YPGLKGDEGEVGDPGEDNNDISPRGVKGAKGYRGPEGPQGPPGHVGPPGPDECEILDIIM
KMCSCCECTCGPIDILFVLDSSESIGLQNFEIAKDFIIKVIDRLSKDELVKFEPGQSHAG
VVQYSHNQMQEHVDMRSPNVRNAQDFKEAVKKLQWMAGGTFTGEALQYTRDRLLPPTQNN
RIALVITDGRSDTQRDTTPLSVLCGADIQVVSVGIKDVFGFVAGSDQLNVISCQGLSQGR
PGISLVKENYAELLDDGFLKNITAQICIDKKCPDYTCPITFSSPADITILLDSSASVGSH
NFETTKVFAKRLAERFLSAGRADPSQDVRVAVVQYSGQGQQQPGRAALQFLQNYTVLASS
VDSMDFINDATDVNDALSYVTRFYREASSGATKKRVLLFSDGNSQGATAEAIEKAVQEAQ
RAGIEIFVVVVGPQVNEPHIRVLVTGKTAEYDVAFGERHLFRVPNYQALLRGVLYQTVSR
KVALG
NT seq 3078 nt   +upstreamnt  +downstreamnt
atgaggctggcccacgctctgctgcccctgctgctacaagcctgctgggtggccacacag
gacatccagggctccaaagcgattgccttccaagactgccctgtggatctattcttcgtg
ctcgacacctcggagagtgtggccttgaggctgaaaccttatggggccttggtggacaag
gtgaagtccttcactaagcgcttcattgacaacctgagagacaggtactaccggtgtgac
cgcaacctggtttggaatgcgggtgcgctgcactacagtgacgaggtggagatcatccga
gggctcacgcgcatgcccagtggccgcgatgagctcaaggccagcgtggatgcggtcaag
tacttcgggaaaggcacctacaccgactgcgccattaagaaggggctggaggagctgctc
atagggggctcccacctgaaggagaacaagtacttgatcgtggtgaccgacgggcatcct
ctagagggctacaaggaaccatgcgggggtctggaagatgcagtaaatgaggccaaacac
ctgggcatcaaggtcttttctgtggccatcacacctgaccacctggagccacgtctaagt
atcattgccacagaccacacataccggcgcaatttcacggcagctgactgggggcatagc
cgcgatgcagaagaggtcatcagccagaccattgacaccattgtggacatgattaaaaat
aacgtggaacaagtgtgttgttcttttgagtgccaggctgccagaggacctccagggccc
cgaggcgaccctgggtatgagggggagcgaggaaagccaggtcttccgggagagaaggga
gaagctggagaccctggacgacctggggatcttggaccagtcgggtaccagggtatgaag
ggagaaaaggggagccgtggagagaagggttccagaggaccgaaaggttacaagggcgag
aaaggcaagcgcggaatcgacggggtcgacggcatgaagggagagacggggtacccagga
ctaccgggctgcaagggctccccaggatttgatggcattcaaggacccccgggtcccaag
ggtgatgctggtgcctttgggatgaagggagaaaagggtgaagctggagcagacggtgag
gctgggagaccagggaactcagggtcacctggagatgagggtgatcctggagagcctggt
ccccccggagaaaaaggagaggccggtgatgaaggaaatgctggcccagacggtgcccct
ggagagaggggtggccctggtgaaagaggacctcgggggacccctggtgtgagaggacca
aggggagacccgggtgaagctggaccacagggtgaccaaggaagagaggggcccgtcggc
atccctggagactcgggtgaggctggccccattggacctaaaggataccgaggtgatgag
ggtcctccaggtcctgagggcctcagaggagccccaggacctgttggtcctcctggagac
cccggactgatgggtgagagaggtgaggatggaccaccaggaaacggcacggaaggtttc
cccggcttccctgggtatccaggcaacagaggccctcctgggctaaatggcacaaaaggc
taccctggcctcaagggggatgagggtgaagtgggagacccaggagaggataacaacgac
atttcaccccgtggggtcaaaggggcaaagggataccgaggcccagaaggaccccaggga
cctccaggacatgtgggaccacctgggccagatgagtgtgagatcctggatatcatcatg
aaaatgtgctcctgctgtgagtgcacatgtggacccattgacatcctcttcgtgctggac
agctcggagagcattggcctacagaactttgagattgccaaggacttcatcatcaaggtc
attgaccggttgagcaaggatgagctggtcaaatttgagccagggcagtctcacgcgggc
gtggtacagtacagccacaaccagatgcaagagcacgtggacatgcggagccccaacgtc
cgcaacgcccaggacttcaaagaagctgtcaagaagctacaatggatggctggtggcaca
ttcaccggagaagcgctgcagtacacccgggaccggctactcccacccacacagaacaac
cgaattgccctggtcattacggatggacgttctgacactcaacgggacacgacacctctc
agtgtgctctgtggtgcagacattcaggtagtttctgtgggaatcaaggatgtgtttggc
tttgtggcgggctccgaccagctcaatgtcatttcctgccaaggcttatcgcaaggtcgg
ccaggtatctccctggtgaaggagaactatgcagagcttctcgatgacggctttctgaag
aacataacagcccagatctgtatagataagaagtgtccggattatacctgtccaatcaca
ttctcctccccggctgacatcaccatcctgctagacagctcagccagtgtcggcagccac
aacttcgaaaccaccaaggtcttcgccaagcgcctagctgagcgattcctgtcagcaggc
agggcggatccttcccaggatgtgcgggtggccgtggtacagtatagtggccaggggcag
caacagccaggtcgggcggctcttcagttcttacagaattacacagtgctggccagctct
gtggacagcatggatttcatcaacgacgccacagacgtcaacgatgctctgagctacgtg
actcgtttctaccgggaagcctcgtcaggtgccaccaagaagagagtgctgttgttttca
gacggcaactctcagggggccacagcagaggccattgagaaggctgtgcaggaggcccag
cgtgcaggcattgagatctttgtggtggtggtgggaccccaggtgaacgagccccacatc
cgtgtgcttgtcactggcaagactgcagagtacgacgtggcctttggcgagcgccaccta
ttccgtgtaccaaactaccaggccctgctacgtggcgtactctaccagacagtctccagg
aaggtggcactgggctag

DBGET integrated database retrieval system