KEGG   Mus musculus (mouse): 12834
Entry
12834             CDS       T01002                                 

Gene name
Col6a2, Col6, Col6a-2
Definition
(RefSeq) collagen, type VI, alpha 2
  KO
K06238  collagen type VI alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12834 (Col6a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12834 (Col6a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12834 (Col6a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12834 (Col6a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12834 (Col6a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12834 (Col6a2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12834 (Col6a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12834 (Col6a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12834 (Col6a2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12834 (Col6a2)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3 Ins134_P3_kin_N
Other DBs
NCBI-GeneID: 12834
NCBI-ProteinID: NP_666119
MGI: 88460
Ensembl: ENSMUSG00000020241
Vega: OTTMUSG00000020488
UniProt: Q02788
Position
10 C1; 10 39.32 cM
AA seq 1034 aa
MTTIKMLQGPLSVLLIGGLLGVLHAQQQEAISPQEQEAVSPDISTTERNNNCPEKADCPV
NVYFVLDTSESVAMQSPTDSLLYHMQQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQV
EVFSPPGSDRASFTKSLQGIRSFRRGTFTDCALANMTQQIRQHVGKGVVNFAVVITDGHV
TGSPCGGIKMQAERAREEGIRLFAVAPNRNLNEQGLRDIANSPHELYRNNYATMRPDSTE
IDQDTINRIIKVMKHEAYGECYKVSCLEIPGPHGPKGYRGQKGAKGNMGEPGEPGQKGRQ
GDPGIEGPIGFPGPKGVPGFKGEKGEFGSDGRKGAPGLAGKNGTDGQKGKLGRIGPPGCK
GDPGSRGPDGYPGEAGSPGERGDQGAKGDSGRPGRRGPPGDPGDKGSKGYQGNNGAPGSP
GVKGGKGGPGPRGPKGEPGRRGDPGTKGGPGSDGPKGEKGDPGPEGPRGLAGEVGSKGAK
GDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSGQPGPKGDPGRPGFSYPGPRGTPG
EKGEPGPPGPEGGRGDFGLKGTPGRKGDKGEPADPGPPGEPGPRGPRGIPGPEGEPGPPG
DPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRL
GAIAKDPKSETGTRVGVVQYSHEGTFEAIRLDDERVNSLSSFKEAVKNLEWIAGGTWTPS
ALKFAYNQLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCDRDVTVTAIGIGDMFHE
THESENLYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPELPCQTELYVA
QCTQRPVDIVFLLDGSERLGEQNFHKVRRFVEDVSRRLTLARRDDDPLNARMALLQYGSQ
NQQQVAFPLTYNVTTIHEALERATYLNSFSHVGTGIVHAINNVVRGARGGARRHAELSFV
FLTDGVTGNDSLEESVHSMRKQNVVPTVVAVGGDVDMDVLTKISLGDRAAIFREKDFDSL
AQPSFFDRFIRWIC
NT seq 3105 nt   +upstreamnt  +downstreamnt
atgactactatcaagatgctccagggtcctctttctgtgctcctgattgggggactcttg
ggggtcctccatgcccagcagcaggaagccatctcaccccaggagcaggaagctgtctca
ccagacatctccaccactgaaaggaacaacaattgtccagagaaggccgactgcccagtc
aacgtgtatttcgtgttggacacctcagagagcgtggccatgcagtccccgacagacagc
ctgctctatcatatgcagcagttcgtaccgcagtttatcagccagctgcagaacgagttc
tacctggaccaggtggccctgagctggcgctacggtggtctacacttctcggaccaagtg
gaggtgttcagcccaccgggcagtgaccgggcctccttcactaagagcctacaaggcatc
cgctccttccgcaggggcaccttcactgactgtgcattggctaacatgacgcagcagatc
cggcagcacgtaggcaagggggtggtcaacttcgccgtggtcatcactgacggccacgtc
acgggcagtccgtgtgggggcatcaagatgcaggctgagcgtgcccgtgaagagggcatc
cggctcttcgctgtggcccctaacaggaacctaaacgaacaaggcctgagggacatcgct
aactctccacatgagctctaccgtaacaactacgccaccatgcgacccgactctaccgag
attgaccaggacaccatcaaccgcatcatcaaggtcatgaaacatgaagcctatggagag
tgctacaaggtgagctgcctggagattcctggaccccacggacccaagggttaccgagga
cagaagggtgccaagggcaacatgggtgaaccaggagagcctggacagaaaggacgacag
ggagaccccggcatcgaaggccccattggattcccgggaccgaagggtgtgcctggcttc
aagggagagaagggtgaatttggatcggatggtcggaagggagcgcctggcctagctggc
aagaatggaacagatggacagaagggcaaactgggccgcattgggcctcctggttgcaag
ggagaccccggaagtcggggccccgatggataccctggagaagctggaagcccaggcgag
cgaggagaccagggtgccaagggggactctggccgcccaggacgcaggggaccaccagga
gatcctggagacaaaggaagcaagggatatcaaggcaacaacggagcccctggaagcccg
ggagtgaaaggaggcaagggagggcctggcccccgtggaccaaaaggagagcctggacgc
agaggagaccccgggaccaagggcggccccggcagcgatggtccaaagggagagaaggga
gaccctggtcctgaggggcctcgaggcctggctggagaagttggcagtaaaggagccaag
ggagacagaggtttgcctggacccagaggcccccagggggctcttggagagccaggaaag
cagggatctcgaggagaccctggtgacgccggacctcgaggggattcaggacagccgggc
cccaagggcgatcctggaaggcctggattcagctacccgggacctcgagggacacccggt
gaaaaaggcgagcccggtccaccaggccctgagggaggccgaggagactttggtctgaaa
ggaacacccggacggaagggagataaaggggagccagctgatcctggtccccctggtgaa
cctggccctcgggggccaagaggaatcccaggacctgagggagaacccggccctccagga
gaccctggtctcacggaatgtgatgtcatgacctatgtgagggagacctgtggatgctgc
gactgtgagaagcgctgtggtgccctggatgtggtcttcgtcatcgacagttctgagagt
attggctacaccaacttcaccttggagaagaactttgtcatcaatgtggtcaacaggcta
ggtgccattgccaaggaccccaagtcagaaacaggcacacgtgtgggtgtggtgcagtac
agccacgagggcacctttgaggccatccggctggacgacgagcgagtcaactccctgtct
agtttcaaggaggctgtcaaaaaccttgaatggatcgccggtggcacttggacgccctct
gccctcaagtttgcctataatcagctcatcaaagaaagccggcgccagaagacccgggtg
ttcgcagtggtcatcacggatgggcgccatgacccccgagatgatgacctcaatcttcgg
gcactgtgtgaccgagatgtcactgtgacagccattggcatcggtgacatgttccacgag
actcatgagagtgagaacctctactccattgcctgtgacaagccacagcaagtgcgcaac
atgacgctgttctctgacctggtggccgagaagttcatcgatgacatggaagacgtcctt
tgtccagacccccagatcgtgtgtccagaacttccctgccaaacagagctctatgtggcc
cagtgcacacaacggcccgtggacattgtcttcctgctggatggctcggagcggctgggc
gagcagaacttccacaaggtgcggcgcttcgtggaggacgtgtcccggcgcctgactctg
gcccggagggatgatgacccactcaacgcccgcatggctctgttgcaatatggcagccag
aatcagcaacaggtggccttcccactgacctacaacgtgaccaccatccacgaggccctg
gagagggccacctacctcaattccttttctcacgtgggcacgggcatcgtacacgccatc
aacaacgtggtgcggggggcacggggtggggcgcggcgccacgcagagctctccttcgtc
ttcctcacggacggtgtcaccggcaatgacagcctggaggagtcagtgcactctatgcgt
aagcagaacgtggtgcccactgtggtcgctgtgggcggcgacgtggacatggatgtgctt
actaagatcagcctgggtgacagggcggccatcttccgggagaaagactttgacagtctg
gcccagcccagcttctttgacaggttcatccgctggatctgttag

DBGET integrated database retrieval system