KEGG   Mus musculus (mouse): 12835Help
Entry
12835             CDS       T01002                                 

Gene name
Col6a3, AI507288, Col6a-3
Definition
(RefSeq) collagen, type VI, alpha 3
  KO
K06238  collagen, type VI, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12835 (Col6a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12835 (Col6a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12835 (Col6a3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12835 (Col6a3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12835 (Col6a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12835 (Col6a3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12835 (Col6a3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12835 (Col6a3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   12835 (Col6a3)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   12835 (Col6a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI fn3
Motif
Other DBs
NCBI-GeneID: 12835
NCBI-ProteinID: NP_001229937
MGI: 88461
Ensembl: ENSMUSG00000048126
Vega: OTTMUSG00000022359
UniProt: Q9Z0I9
Structure
PDB: 

Position
1 D; 1 45.53 cM
AA seq 3284 aa AA seqDB search
MRKHRHLPLVAVFSLLLSGIATTHAQQHGDVKNGAAADIVFLVDSSWSAGKDRFLLVQEF
LSDVVESLAVGDNDFHFALVRLNGNPHTEFLLNTYHSKQEVLSHIVNMSYIGGSNQTGKG
LEYVIHSHLTEASGSRAADGVPQVIIVLTDGQSEDGFALPSAELKSADVNVFAVGVEGAD
ERALGEVASEPLSMHVFNLENVTSLHGLVGNLVSCIHSSVNPERAGDKESLKDITAQDSA
DIIFLIDGSQNTGNANFDVIRDFLVNVLERLSVGNQQVQVGVVQYSEEPITMFSLNSYPS
KAAVLDAVKGLSLVGGESANIGQALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSDE
IRDSVVALKQASVFSFGLGAQAASRAELQHIATDDSLVFTVPEFRSFGDLQEQILPYLVG
VAQRHIVLQPPAIVTQVMEVNKRDIVFLVDGSSSLGPSNFNAIRDFVTRVIQRLEIGQDL
VQVSVAQYADTVKPEFYLNSYTNKRDAITAVRKMRALNGSALYTGSSLDFVRNNLFTSSA
GHRAAEGVPKLLVLITGGKSLDEVSQPAQELKRGSIMALAVGSKAADEDELKEIAFDSSL
VFIPAEFRPAPLQNMLPSLMAPLRTLTGTTEVHVNKRDIIFLLDGSDNVGKNNFPYVRDF
VTNLVNSLDVGSDNIRVGLVQFSDTPVTEFSLDTYQTKSELLAHLRRLQLKGGSGLNAGS
ALSYIHANHFTEAGGSRTREHVPQLLLLLMAGPSEDAYLQAANALVRSGVLTFCVGTNRA
DKAELEHIAFNPSLVYLMDDFRSLPSLPQQLIQPLTTYVSGGVQEVPLSQPESKRDILFL
FDGSVNVLGQFPAVRDFLYRIIEELDVKPDGTRVAIAQFSDDVRLESRFSEHQTKAEILN
LVKKMKLKTGKALNLGYALDYALRNIFVRSAGSRIEDNVQQFLVLLVAGRSSDAVAGPAS
SLKQRGVVPFIFQAKNANPSELEQIVLSPAFILAAESLPKIGDLQSQIVSLLKAEQGSGP
VSGEKDVVFLIDGSEGVRSGFPLLKDFVQRVVESLDVGPDRVRVALVQYSDRTRPEFYLN
SHMDQQGVISAIRRLTLLGGPTPNTGAALEFVLRNILTSSTGSRIAEGVPQLLIVLTAEP
SGDDVRGPSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISE
RVIQLNREELSSLKPILTPSTGAGVGSKKDVVFLIDGSRNAGPEFQYIRTLIERIVEYLD
IGFDTTRVAVIQFSEDSKMEFPLNAHFSKDEVQNAVRRLRPKGGSQVYIGNALEYVLKNI
FQRPLGSRIEEGVPQFLVLISSGKSDDEVDDSAVELKQFGVAPLTIARHTDQEELVKISL
SPEYVYSVSTFRELPRLEQKLLTPITTLTSQQIHQILASTRYPPSVVESDAADIVFLIDS
SDAVKPDGIAHIRDFVSRIVRRLNIGPSKVRIGVVQFSNDVFPEFYLKTHKSQSSVLEAI
RRLRFKGGSPLNTGRALEFVARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVARHAQVI
SSSGIVSLGIGDRNIDRTDLQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGATPQPP
GVDLPSPSRPEKKKADIVFLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQY
NSDPTDEFFLRDFSTKRQIIDAINKVVYKGGRHANTRVGIEHLLRNHFVPEAGSRLDERV
PQIAFVITGGKSVEDAQDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQ
ELSELSETVLETLHDAMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVD
IILNRISQIQRISCSGNQLPTVRVSVMANTPSGPVEAFDFAEYQPELFEKFRNMRSQRPY
VLTADTLKLYQNKFRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGAQALILVGLE
RVANLERLMHLEFGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDR
GPIGSIGPKGISGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEK
GELGEIGLDGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRD
SQQRGPKGETGDIGPMGLPGRDGIPGSPGDPGKDGGSGRRGPAGAKGNRGGPGQPGFEGE
QGTRGSQGPPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGS
IGNRGPRGETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRR
GNSGPPGATGQKGDPGYPGPSGHKGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTEL
AFALDTSEGVTQDTFSRMREVLLGIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADS
KKKSALLDSIQNLQVALTSKQQSLETAMSFVARNTFKRVRSGFLMRKVAVFFSNKPTRAS
PQLREAVLKLSDAGITPLFLTSQEDRQLINALQINNTAVGHALVLPARRDLTDFLKNVLT
CHVCLDICNIDPSCGFGSWRPSFRDRRAAGSDVDIDLAFILDSSEATTLFQFNEMKKYIG
YVIRQLDLSPDPKASQHFARVAVVQQSTYESVDNASVPPVKVEFSLTDYGAKEKLLDFLS
RRMTQLQGTMGLGNAIEYTIENIFESAPNPRDLKIMVLMLTGDMQRQQLEEAQRAILQAK
CKGYFFVVLGIGRKVNIKEVYSFASEPNDVFFKFVDKSTELNEEPLMRFGRLLPSFVSSE
NAFYLPPDLRKQCDWFQGDQPVKNGVKFGHKQINPPHTANSSLTSKVVTTMKPVTTTKPT
AIVNLPPAKPAPARPAPAQPVLAKPDPAKPAQARPAPAKPASAKLVPPQPVHVQPAPAQT
ASVRPAPAKPAPPQPAAAKPVPAKPAVPAQPAPPQPAAAKPVPAKPAVPAQPAPPQPAAA
KPVPAKPAVPAQPAAAQPMPAQPVLTKSAAVKPASANKPVAAKPVATNTATATARPALAA
KPAAAKPAATRPLAAAIRPVATKPEAPRQQAKPAATKPATTKPLARVSREVQVSEVTENS
ARLHWERPEPSSSFFYDLTVTSAHDQSLVLRQNLTVTDRVIGGLLAGQLYHVVVVSYLQS
QVRAIYQGSFNTKKTQPPPLQAAHRASSSTINLMVNTEPLFLTKTDICKLSRDAGTCVDF
KLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV
NT seq 9855 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacaccggcatctgcccctagtggctgtctttagccttctcctctcaggcatt
gccacgactcatgcccaacagcatggagatgtcaaaaacggtgcggcggctgacatagtg
tttctagtggattcctcttggagtgctgggaaggaccgtttcctgcttgttcaagagttt
ctgtctgatgttgtagagtctttagctgtgggagacaatgattttcactttgctctggtc
cggctcaacggaaacccacataccgagttcctgttaaatacataccactctaaacaagaa
gtcctttctcatattgtgaacatgtcttacattgggggaagcaaccaaactggaaaagga
ttagaatacgtaattcacagccacctcactgaggcttccggaagccgggctgctgacgga
gtccctcaggttatcatagtattaactgatggacaatcggaggatggcttcgctctgccc
tcagcggaacttaagtctgcggacgttaatgtgtttgcagtcggagttgagggtgcagat
gaaagagccctaggagaagtagcaagcgaaccactcagtatgcatgttttcaacctagag
aacgttacctcactgcatggcctagtagggaacttagtgtcctgtatacactcctctgtg
aatccagaaagggctggggacaaggaaagccttaaagacatcacagcacaagactcagct
gacattattttccttattgatggatcacagaacaccggaaatgccaatttcgatgtcatt
cgagacttccttgtaaatgtccttgagagactctcagttggaaaccagcaggtccaagtg
ggggtggtacagtatagcgaggagcccataaccatgttctccttgaatagctacccctcc
aaggctgcagttctggatgccgtgaaagggctcagcttggttgggggggagtcggccaat
ataggccaggctcttgactttgtagtggagaatcacttcactcgggcaggtggcagccgc
gtggaggaaggggtcccccaggtgctggtcctcataagtgctgggccttctagtgatgag
attcgagattcggtggtagctctgaagcaggctagtgtgttctcgtttggcctcggagcc
caggcagcctccagggcagagcttcagcacatagctaccgatgacagcttggtgtttact
gtcccggaattccgtagctttggggatctccaggagcaaatactgccgtaccttgttggt
gtggcccaaaggcacattgtcttgcaaccaccagctattgtcacacaagtcatggaagtc
aacaagagggacatagtcttcctggtggatggttcctccagcctggggccatccaacttc
aatgccatccgagacttcgttaccagagtcatccagaggttggaaattggacaggacctg
gttcaggtatcagtggctcagtatgcagacactgtcaagcctgagttctatttaaattcc
tataccaacaaaagggatgccataactgctgtacggaagatgagggccctgaatggctca
gccctgtacacgggatcttctctggactttgttcgaaacaacctcttcactagctcagcc
ggccatagggccgctgagggggttcctaagctcctggtgctgatcacaggcggtaagtcc
ctcgatgaagtcagccagcctgcccaggagctgaagagaggcagcatcatggccttggcc
gttggcagcaaggccgccgatgaggatgagctgaaagagatcgctttcgactcctccctg
gtcttcattcccgctgagttccgccctgctcccttgcaaaacatgctgcccagcctgatg
gcacctctcaggactctcactggaaccacggaagttcacgtaaacaaacgggatatcatc
ttccttttggatggctccgacaacgttgggaaaaacaatttcccttatgtgcgtgacttt
gtaaccaacctagttaacagcctcgatgttggaagtgacaatatccgtgttggcttggtg
cagtttagtgacactccggtcacggagttctctctagacacttaccagaccaagtccgag
ctgctcgctcacctgaggcgcttgcagctcaaggggggctccggcttgaacgcaggctct
gccttgagctatatccatgccaatcacttcacggaggcaggaggcagcaggactcgtgaa
cacgtgcctcagctgctgctcctgctcatggccgggccctctgaggatgcctatttgcaa
gctgccaatgccctggtgcgctcaggcgtgctgaccttctgtgtggggaccaatcgggcg
gataaggctgagttagagcatattgcttttaatcccagcctggtatacctcatggacgat
ttccgctccctgccatctttgcctcaacagctgattcagcccctaaccacatatgttagt
ggaggtgtacaggaagttccactatcccagccagagagcaagcgggacattcttttcctc
tttgacggctcagtcaatgtcttgggtcagttccctgctgtcagagactttctctacagg
atcattgaggaacttgatgtgaagccggatgggacccgggtagcaatagctcagttcagt
gatgacgtcaggctggagtcccgcttcagtgagcaccagacgaaagctgaaatccttaat
ctcgtgaagaagatgaagctaaaaacaggcaaagccctcaacctgggctacgccctggac
tacgcgcttaggaacatctttgtgaggtcggctggcagccgcatcgaggataacgtgcag
cagttcctggtgctgctggttgctggaaggtcgtcagatgctgtggccgggcctgcaagc
tccctgaagcagagaggagtggtacctttcatctttcaagccaagaacgccaaccccagt
gagctggagcagattgtgctgtcgcctgcattcatcctggctgcagagtcactccctaag
atcggagacctccaatcacagattgtgagccttctgaaagcagaacagggttcaggccct
gtatcaggtgaaaaggatgtggtgtttctcattgatggctctgagggtgtccgcagtggc
ttccccctgctaaaggactttgtgcagagggttgtggagagcttggatgtgggtcccgac
cgtgtgcgtgtggcactggtgcagtacagtgaccggaccaggccggagttctacctgaat
tcccacatggaccagcagggtgtcatcagcgccatccgcaggctgacactgctgggcggc
ccaacccccaacacaggggcggcactggagttcgtgttaaggaacattctgaccagttct
actgggagcaggatagcagaaggtgttcctcagctcctgattgtcctcacagcagagcca
tcaggggatgacgtgcgaggcccttcagtagtcctgaagcagggcggggctgtgcccatt
ggcattggcattgggaatgctgacatctctgaaatgcagaccatctccttcatccctgac
tttgctgtggccatccccaccttccgggagcttgggacgatacagcaggtcatctctgag
agggtgatccagcttaatcgtgaggagctgagctcgttgaaacccattttgacgccctca
acaggtgcaggtgttggcagcaagaaagatgtggtctttctcatcgatggatcccgaaat
gctggccctgagttccagtacatccgtaccctgattgagaggatagtcgagtacctggac
ataggctttgacaccacccgggtagccgtcatccagttcagtgaggactccaagatggag
tttcctctgaatgcccacttcagcaaggatgaagtacagaacgctgtgcgcaggctgcgg
cccaagggtgggagtcaggtctacatcggaaatgccctggagtacgtgctgaagaacatc
ttccagaggccactggggagccggatagaagagggcgttccgcagttcctagtcctcatt
tcgtctggaaagtctgatgatgaggtggacgactcagccgtggaactcaagcagttcggt
gtggcccctctcaccatagccagacacacagaccaagaggagctggtgaagatctcccta
agtcctgagtacgtgtactccgtgagcaccttcagggagctgcccagactggagcagaag
ctgctgacgcccatcaccactctaacctcacagcagatccatcagatcctggccagtacc
cgatatcccccttcagtggttgaaagcgatgcggctgacatcgtctttctgattgacagc
tctgatgccgtcaagcccgatggcatcgctcatatccgagactttgtcagcaggatcgtt
cgcagactcaacattggtcccagtaaagtgaggattggggtcgtgcagtttagcaatgat
gtcttccctgagttctacctgaagacccacaagtcccagagcagtgtgcttgaagccata
cggcgtctgaggttcaaaggagggtctcccctaaacactggcagagccctggagtttgtg
gcaagaaacctcttcgtgaagtctgctgggagccggatagaagatggggtccctcaacac
ctggtcttattcctgggtgggaagtctcaggacgatgtggccaggcatgcccaagtcata
agctcatcggggattgtgagcttaggaataggagatcggaacattgataggacggacttg
caaaccatcaccaatgaccccaggctggtcttcacagttcgggaattcagagagctgccc
aacatagaagagagggtcatgctttcctttggaccctctggggctactcctcagcctcct
ggggtagatttaccttctccttcccggccagagaagaagaaggccgacattgtgttcctg
ctggatggttccatcaattttaggagggacagtttccaggaagtgctccgttttgcatct
gaaatcgtggacacggtctatgaagacggagattccatcagagtgggactggtccagtac
aactcagaccccacggatgaattcttcctgagggacttttctaccaaaaggcagattatc
gatgccatcaacaaagtcgtctataaaggagggaggcatgccaacaccagggtgggcatc
gagcacctgctgcggaatcactttgtgccggaggctggtagccgcctggatgagcgggtt
cctcagatcgccttcgtgatcaccggagggaagtcagtggaggatgctcaggatgtgagc
ctggctctcacccagaaaggtgtcaaggtgtttgccgttggcgtgaggaacatcgactct
gaggaggtgggcaagatagcctccaacagtgccacagccttccgggtgggcagcgtgcag
gaactgtccgaactgagtgagacagtgctcgagactctgcatgatgcaatgcatgagacc
ctctgccctggtgtgaccgatgtctccaaagcctgcaatctggaagtcattctggggttt
gatggatctcgagatcagaatgtgtttgtgagtcagaagggccttgagtccaaggtggac
atcatcttgaacagaatcagccagatacaaaggatcagctgcagtggcaaccagctgccc
actgtgagggtatccgtgatggcgaacacgccctctgggccagtggaggcctttgacttt
gccgagtatcagccggagctgtttgagaagtttcgcaacatgcgcagtcagcgcccatac
gtcctcacagctgacacgctgaagttgtaccagaacaagttcaggcagtcgtcgcctgat
actgtgaaggtagtcattcacttcacggatggagcagatggagacatggctgacttatac
agagcatctgaggaactccggcaagcaggtgcccaagccctgatcctggtgggtcttgaa
cgtgtggctaacctggagcggctgatgcatctggagttcgggcggggcttcatgtatgac
aggcccctgaggctcaacctgcttgacttagactatgaactggcagagcagcttgacaat
attgctgagaaagcttgctgtggggttccatgcaagtgctctggagagaggggagacaga
gggcccattggcagcattgggccaaagggtatctccggggaagatggctaccgaggctac
ccgggagacgaaggcggacctggtgagcgaggtccacctggtgtgaatggcacacaaggt
ttccagggctgtccaggccagaggggagtgaagggttctcgaggattcccaggagagaag
ggtgaattgggagaaatcggcttggatggtctggatggtgaagagggagacaaggggctg
cctggttcttctggagaaaaggggagtcctggaagaaggggtgacaaaggacccaaagga
gacaaaggcgagagaggagatgtcgggattcgaggtgacccgggtgactcaggacgggac
agccagcagagaggacccaaaggagagacgggagacatcggccccatgggtctcccaggc
agagatggcatccctggcagcccaggagaccctgggaaggacggtggctctggccgaagg
ggccctgcaggagctaagggcaacagaggtggtcctggccagccaggcttcgaaggcgag
cagggtaccagaggctcacagggcccacctggtcccattggtcccccaggcctgattggg
gaacaaggaattcccggacctcgaggaggcggaggtacggctggggctcctggagaacgt
ggcagaactggtcctctggggaggaagggtgagccaggagagccagggccgaagggaagc
atcgggaaccgtggaccccgaggagagacgggagatgacgggagagatggggttggcagt
gaaggacgcagaggcaaaaaaggagaaagaggcttccctgggtatccgggaccaaagggc
acccctggtgagccaggggcagatggaccaccaggacccaaaggcatcagaggtcgaagg
ggaaattcaggacctccaggggcaactggacaaaagggagaccctggttacccaggacca
tctggtcacaagggcaaccgaggcgactccgttgatcaatgcgccctcatccagagcatc
agagacaaatgcccttgctgctacgggcccctggagtgccctgtattcccaacagaactc
gcctttgccctggatacctctgagggggtgactcaggacaccttcagccggatgcgagag
gtgcttctgggcattgtgggcgatctgaccattgcagagagcaactgtccgcggggtgcc
cgcgtggctgtggtcacctataacaatgaggtgactacagagatccggtttgctgactcc
aagaagaagtctgccctcttagacagtattcagaacctccaagtggccttgacctctaag
cagcagagcctggagaccgcaatgtcattcgtggccaggaatacattcaaacgtgtgagg
agtggcttcctgatgaggaaagtggctgttttcttcagcaacaagcccaccagggcatcc
ccccagctccgagaggccgtactcaagctttccgatgcggggatcacacccttgttcctt
acaagccaggaggaccgacagctcatcaacgctttgcagatcaataacacagcagtggga
catgccctggttctgcctgcaaggagggatctcacagacttcctgaagaatgtccttacc
tgccatgtttgcttggacatttgcaatatcgacccatcctgtggcttcggcagctggagg
ccttccttcagggaccggagggcagcaggcagtgatgtggacatagacctggctttcatc
ttggacagctcagaggctaccacactgttccagttcaatgagatgaagaaatacataggc
tatgtgatcagacagctggacctgagcccagacccgaaggcttcccaacactttgccagg
gtggctgttgtgcagcagtcaacctacgagtctgtggacaatgccagtgtgccgcctgtg
aaggtggaattctcactgacagactatggtgccaaggaaaagctgttggatttccttagc
cggaggatgacccaacttcagggaaccatgggcctgggcaatgccattgaatacactata
gagaacatctttgaaagtgctccaaacccacgggacctcaaaattatggtgctgatgttg
actggtgacatgcagaggcagcagctggaggaggcccagagagccatcctccaggccaag
tgcaagggttacttctttgtggttctgggcattggcaggaaggtgaatatcaaggaggtc
tacagctttgccagtgagcccaatgatgtcttcttcaaatttgtggacaaatcaactgag
ctcaacgaggagcctctgatgcgctttgggaggctgctcccatcctttgtcagcagtgaa
aatgcattttacctgcctccagatctcaggaaacagtgtgattggttccaaggggaccaa
ccagtgaagaatggcgtgaagtttggtcacaaacagataaaccctccacatactgctaat
tcaagtcttacatccaaagttgtgaccacaatgaagccagtgacaacgaccaaaccaaca
gcaattgtaaacctgccacctgctaagccagccccagcgaggccagcccctgctcagcca
gttcttgctaagccagaccccgcaaaaccagcccaagcaaggccagcccctgctaagcca
gcttctgctaagttggtgcctcctcagccagtccatgttcagccagcccctgcccagaca
gcttctgtaagaccagcccccgctaagccagcccctcctcagccagctgctgctaagcca
gtccctgctaagccagcagtccctgctcagccagcccctcctcagccagctgctgctaag
ccagtccctgctaagccagcagtccctgctcagccagcccctcctcagccagctgctgct
aagccagtccctgctaagccagcagtccctgctcagccagccgctgctcaaccaatgcct
gctcagccagtccttactaaatcagccgctgtgaaaccagcctctgccaacaagcctgtg
gcagccaaacctgtggccacgaacacagccacagccacagccagacctgcattagcagcg
aagcctgctgcagcgaagcctgcagcaacgagaccccttgctgctgccataaggccagtt
gctaccaagccagaggcccccaggcaacaggccaaaccagctgccaccaagccagccact
actaagcccttggcgagagtgtcccgagaagtccaggtctctgaagtcacggagaacagt
gccagactccactgggagcggcccgagccttccagctcctttttttatgacctcactgta
acctcggcccacgaccagtccttggttctgagacaaaacctcactgtcactgaccgtgtc
atcggaggcctactggctggacagctgtaccatgtcgtagtggtctcctacctgcagtct
caggtcagggccatctaccaaggaagtttcaatacgaagaaaacccagcctccacctctt
caggcagcacaccgagcatccagttcaaccatcaacctcatggtgaacacagaaccattg
tttctcactaaaacagatatatgtaagctgtccagagatgctgggacttgtgtggacttc
aagttactatggcactatgacctagagagcaaaagttgcaagagattctggtatggaggt
tgtggaggcaacgagaacagattccactcccaggaagaatgtgaaaagatgtgtagtcct
gagttaacagtttga

DBGET integrated database retrieval system