KEGG   Mus musculus (mouse): 12836Help
Entry
12836             CDS       T01002                                 

Gene name
Col7a1, AW209154
Definition
(RefSeq) collagen, type VII, alpha 1
  KO
K16628  collagen, type VII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12836 (Col7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen fn3 VWA VWA_2 Kunitz_BPTI Pur_ac_phosph_N DUF4992
Motif
Other DBs
NCBI-GeneID: 12836
NCBI-ProteinID: NP_031764
MGI: 88462
Ensembl: ENSMUSG00000025650
Vega: OTTMUSG00000021336
UniProt: Q63870
Position
9 F2; 9 59.63 cM
AA seq 2944 aa AA seqDB search
MRLRLLVAALCAAEILMGAPEVWAQPRDRVTCTRLYAADIVFLLDGSSSIGRSNFREVRG
FLEGLVLPFSGAASAQGVRFATVQYSDDPQTEFGLDTLGSGSDTIRAIRELSYKGGNTRT
GAALHHVSDRVFLPRLTRPGVPKVCILITDGKSQDLVDTAAQKLKGQGVKLFAVGIKNAD
PEELKRVASQPTSDFFFFVNDFSILRTLLPLISRRVCTTAGGVPVTLPSDDTPSGPRDLV
LSEPSSQSLRVQWTAASGPVTGYKVQYTPLTGLGQPLPSERQEVNIPAGETSTRLQGLRP
LTDYQVTVVALYANSIGEAVSGTARTTAKEGLELSLQNITSHSLLVAWRRVPGANGYRVT
WRDLSGGPTQQQDLSPGQGSVFLDHLEPGTDYEVTVSALFGHSVGPAASLTARTASSVEQ
TLHPIILSPTSILLSWNLVPEARGYRLEWRRESGLETPQKVELPPDVTRHQLDGLQPGTE
YRLTLYTLLEGREVATPATVVPTGLEQLVSPVMNLQAIELPGQRVRVSWNPVPGATEYRF
TVRTTQGVERTLLLPGSQTTFDLDDVRAGLSYTVRVSARVGAQEGDASILTIHRDPEAPL
VVPGLRVVASDATRIRVAWGLVPGASGFRISWRTGSGPESSRTLTPDSTVTDILGLQPST
SYQVAVSALRGREEGPPVVIVARTDPLGPVRRVHLTQAGSSSVSITWTGVPGATGYRVSW
HSGHGPEKSLLVSGDATVAEIDGLEPDTEYIVRVRTHVAGVDGAPASVVVRTAPEPVGSV
SKLQILNASSDVLRVTWVGVPGATSYKLAWGRSEGGPMKHRILPGNKESAEIRDLEGGVS
YSVRVTALVGDREGAPVSIVITTPPATPALLETLQVVQSGEHSLRLRWEPVPGAPGFRLH
WQPEGGQEQSLTLGPESNSYNLVGLEPATKYQVWLTVLGQTGEGPPRKVTAYTEPSHIPS
TELRVVDTSIDSVTLTWTPVSGASSYILSWRPLRGTGQEVPRAPQTLPGTSSSHRVTGLE
PGISYVFSLTPIQSGVRGSEISVTQTPACSHGPVDVVFLLHATRDNAHNAEAVRRVLERL
VSALGPLGPQAAQVGLLTYSHRPSPLFPLNSSHDLGIILRKIRDIPYVDPSGNNLGTAVT
TAHRYLLASNAPGRRQQVPGVMVLLVDEPLRGDILSPIREAQTSGLKVMALSLVGADPEQ
LRRLAPGTDPIQNFFAVDNGPGLDRAVSDLAVALCQAAVTIEPQTGPCAVHCPKGQKGEP
GVTGLQGQAGPPGPPGLPGRTGAPGPQGPPGSTQAKGERGFPGPEGPPGSPGLPGVPGSP
GIKGSTGRPGPRGEQGERGPQGPKGEPGEPGQITGGGGPGFPGKKGDPGPSGPPGSRGPV
GDPGPRGPPGLPGISVKGDKGDRGERGPPGPGIGASEQGDPGLPGLPGSPGPQGPAGRPG
EKGEKGDCEDGGPGLPGQPGPPGEPGLRGAPGMTGPKGDRGLTGTPGEPGVKGERGHPGP
VGPQGLPGAAGHPGVEGPEGPPGPTGRRGEKGEPGRPGDPAVGPGGAGAKGEKGEAGLPG
PRGASGSKGEQGAPGLALPGDPGPKGDPGDRGPIGLTGRAGPTGDSGPPGEKGEPGRPGS
PGPVGPRGRDGEAGEKGDEGIPGEPGLPGKAGERGLRGAPGPRGPVGEKGDQGDPGEDGR
NGSPGSSGPKGDRGEPGPPGPPGRLVDAGIESRDKGEPGQEGPRGPKGDPGPPGVSGERG
IDGLRGPPGPQGDPGVRGPAGDKGDRGPPGLDGRSGLDGKPGAPGPPGLHGASGKAGDPG
RDGLPGLRGEHGPPGPPGPPGVPGKAGDDGKPGLNGKNGDPGDPGEDGRKGEKGDSGAPG
REGPDGPKGERGAPGNPGLQGPPGLPGQVGPPGQGFPGVPGITGPKGDRGETGSKGEQGL
PGERGLRGEPGSLPNAERLLETAGIKVSALREIVDTWDESSGSFLPVPERRPGPKGDPGD
RGPPGKEGLIGFPGERGLKGERGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIPGLPG
RAGGSGEAGRPGERGERGEKGERGDQGRDGLPGLPGPPGPPGPKVAIEEPGPGLAREQGP
PGLKGAKGEPGSDGDPGPKGDRGVPGIKGDVGEPGKRGHDGNPGLPGERGVAGPEGKPGL
QGPRGTPGPVGSHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPGPVGAVGLP
GPPGPSGLVGPQGSPGLPGQVGETGKPGPPGRDGSSGKDGDRGSPGVPGSPGLPGPVGPK
GEPGPVGAPGQVVVGPPGAKGEKGAPGDLAGALLGEPGAKGDRGLPGPRGEKGEAGRAGG
PGDPGEDGQKGAPGLKGLKGEPGIGVQGPPGPSGPPGMKGDLGPPGAPGAPGVVGFPGQT
GPRGETGQPGPVGERGLAGPPGREGAPGPLGPPGPPGSAGAPGASGLKGDKGDPGAGLPG
PRGERGEPGVRGEDGHPGQEGPRGLVGPPGSRGEQGEKGAAGAAGLKGDKGDSAVIEGPP
GPRGAKGDMGERGPRGIDGDKGPRGESGNPGDKGSKGEPGDKGSAGSIGVRGLTGPKGEP
GAAGIPGEPGAPGKDGIPGFRGDKGDIGFMGPRGLKGEKGIKGTCGRDGERGDKGEAGFP
GRPGLAGKKGDMGEPGLPGQSGAPGKEGLIGPKGDRGFDGQSGPKGDQGEKGERGPPGVG
GFPGPRGNDGSSGPPGPPGGVGPKGPEGLQGQKGERGPPGESVVGAPGAPGTPGERGEQG
RPGPAGPRGEKGEAALTEDDIRDFVRQEMSQHCACQGQFIASGSRPLPGYAADTAGSQLH
HVPVLRVSHVEEEGQVPPEDDDDFSEYSVYSVEDYQEPEVPWDGEAEIKGWDQRGSDLCS
LPLDEGSCTAYTLRWYHRAVPGGTACHPFVYGGCGGNANRFGTREACERRCPPQGVHSQK
TGAA
NT seq 8835 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcgactcctggtcgctgcgctctgcgctgcagagatcctgatgggagcgccg
gaagtgtgggcccagcccagagatagagtgacctgcacacgcctttatgctgctgacatc
gtgttcttactcgatggctcgtcgtccattggccgcagcaactttcgagaagtgcgagga
ttcctggaggggctggtgctgcctttctcaggagcagccagtgcacagggcgtccggttt
gccacagtgcagtacagtgatgatccacagacagaatttggtctggatacacttggctct
gggagtgacaccatccgagccatccgtgagctcagctataaaggtggtaacactcgcacg
ggggccgctcttcaccacgtttctgaccgtgtcttcctgcctcgtctaacacgtcctggt
gtccccaaggtctgcatcctgatcacagatgggaaatcccaagatttagtggacacagct
gcccaaaagctgaaggggcagggagtcaagctgtttgctgtgggaatcaagaatgccgac
cctgaggaactgaagcgtgtggcctcacagccaaccagcgatttcttcttcttcgtcaat
gacttcagcatcttgaggaccctgttgcctctcatttccaggagggtgtgcacaactgct
ggtggtgtgcctgtgaccctgccttctgatgacactccgtctgggccccgggacctggtg
ctctctgagccaagtagccaatccttgcgagtacaatggacagcagccagtggccctgtg
actggctacaaggttcagtacacacctctgacagggctagggcagccactgccaagtgag
cgacaggaggtgaacatcccggctggtgagaccagcacgcgtctccagggtctccggcca
ctaacggactaccaagtgactgtggttgccctctatgccaacagcatcggggaggccgtg
agtgggacagctcggaccactgccaaggaagggctagaattgagcctccagaacatcaca
tcgcacagcctcctggtggcctggaggagggtaccaggtgctaatggctaccgtgtaaca
tggcgggacctcagtggtgggccaacccagcagcaggacctgagccctggacaggggtca
gtgtttctagatcacttggagcctggcacggactatgaggtgaccgtgagcgccctattt
ggccacagcgtggggcctgccgcttctctgactgcccgcaccgcatcttctgttgagcaa
accctgcatcccatcatcttgagcccgacatccatcctcctttcctggaacttggtgcct
gaggcccgcggctaccgcttggagtggcgtcgtgagagtggcttggaaacaccacagaaa
gtggaactgccccctgatgtgacccgccatcagctggatggtttgcagccaggcactgag
taccgtctcacgctgtatactctgctggagggccgtgaggtggccactcctgcaaccgtg
gttcctacagggctagagcagctggtgagcccggtgatgaatttacaagccatagaacta
cctgggcagcgggtgcgagtgtcttggaacccagtccctggggccactgagtaccgtttc
actgtacgcaccacccagggggtcgagcggactctattgcttcctgggagccagacaacc
tttgacttagatgatgttcgagctgggcttagctacacggtgcgggtgtctgctcgagtg
ggtgctcaggagggtgatgccagcatcctaacgatccacagagatccagaagccccactt
gttgtcccaggactgcgggttgtcgcatcagatgcaacaagaattagggtggcctgggga
cttgtccctggagccagtggatttcggatcagctggaggacaggcagtggtccagagtcc
agccggacgctgaccccagactccactgtcacggacatcctggggttgcagcctagcacc
tcttatcaagtcgctgtctcagcacttagagggagagaagaggggccccctgtggtcatc
gtggctagaactgatccactgggcccagtgaggagagtccacttgactcaggctggcagc
tcatctgtcagcatcacctggactggggttcccggtgccacaggatacagggtttcctgg
cactcaggccatggtccagagaaatctctgttggtttctggagatgccacggtggctgaa
atagatgggctggagccggacacagagtatatagtgcgtgtgagaacccacgtagctggt
gtggatggagcccccgcctctgtggttgtgaggactgctcctgagcctgtgggcagtgtg
tcgaaactgcaaatccttaatgcttccagtgatgttctacgggtcacttgggtaggagtc
cctggggccacatcctataaactggcgtggggacgtagtgaaggtggccctatgaaacac
cggatactcccaggaaacaaagagtctgcagagatacgggatctcgaaggaggagtcagc
tactccgtgagagtgacggcgcttgttggagaccgagagggtgcaccggtgtccattgtc
atcaccacaccgcctgcgaccccagcacttctggagactcttcaagttgtgcagagcggg
gagcactccttgaggctgcgatgggaaccagtacccggagcaccaggcttccgcctgcac
tggcaacctgagggtggccaggaacagtccctgaccttgggacctgagtctaacagctac
aacctggttggtctggagccagcaacaaagtaccaagtatggctgactgtcctgggccag
actggagaaggtccccctaggaaggtgactgcatacactgagccctctcacatcccgagc
actgaactacgcgtggtggatacctctattgactcagtgactttgacctggaccccagtg
tctggggcatccagttatatcttgtcctggcggccgctcagaggaactggccaggaagtg
ccgagggccccacagacactgccagggacctcaagctcccacagagtgacagggctggaa
cctggtatttcctatgttttctctctgacacctatccagagcggtgtacgaggttctgag
atctctgtcacacaaacaccagcgtgttcccatggcccagtggacgtggtgttcctcttg
catgccactcgagacaatgctcacaacgcagaggctgtgaggagggtcctggaaaggctg
gtgtctgcacttgggcctcttggtccacaggctgctcaggtcggcctgctgacttacagc
caccggccctccccactgttcccactgaatagttcccatgatcttggcatcatcttgcga
aagatccgtgacatcccctacgtggacccaagtggtaacaacctcggcacagccgtgacc
acagctcacagatacctcttagcatccaatgctcctggtcgccgtcagcaagtgccaggc
gtgatggtcctgttagtggatgagcctctgagaggggacatactcagccccattcgtgag
gcccagacttctgggcttaaggtgatggcactgagtttggtgggagctgacccagagcag
ctgcgtcgcttggcaccaggcacggaccccatccagaacttctttgctgtggataatggc
ccaggcttggacagagcagtcagtgatctggctgtagccctgtgtcaggcagctgtgacc
atagagccgcaaacagggccttgtgctgtgcactgtccaaagggccagaagggggagcct
ggagtaacgggactgcaaggacaggctggacctcctggcccccctggtctcccgggcagg
accggtgctccaggcccgcaaggtcctcctggaagtacccaggcaaaaggcgagaggggc
tttcctggcccagaagggcctccaggcagtcctggcctccctggagttcctgggtctcct
ggcattaagggctccacggggcggcctggccctcgtggggaacagggagaacgagggcct
caaggtccaaagggggagccgggtgagcctgggcaaatcactggcggtggagggccaggg
tttcctggaaagaaaggggaccctggaccttcggggccccctggatctcgtggccctgtg
ggggacccaggaccccgtggccccccagggcttcctggaatatcagtgaagggtgacaaa
ggtgatcgtggggaacggggtcccccgggaccaggcattggtgccagtgaacagggtgac
cctggacttccggggcttcctggaagccctggaccccaaggcccagctggccgacctgga
gagaagggagaaaagggtgactgtgaggatggaggtccaggcctcccaggacagcctggg
cccccaggggagccgggcctgcggggagctcctggaatgactgggcccaaaggtgatcgg
ggactgacggggaccccgggcgagcctggagtaaagggtgaacggggacatcctggtccc
gtgggaccccaggggctccccggggctgctggacaccctggagtggagggtcctgagggg
ccaccaggacccactggccgccgaggagaaaagggagaacctggtcgccctggggatcct
gcagtgggtcctggtggtgctggagccaaaggagaaaagggagaggctgggctccctggg
cccagaggagcttctggaagcaaaggagagcagggcgcacctggattggctcttcctgga
gatcctggccccaaaggagaccctggagacaggggtcccattggcctcactggaagggca
ggacccacaggtgactcagggcctcctggagagaaaggagagcctggtcgacctggttcc
ccaggacctgttggcccccgaggaagagatggtgaagctggagagaaaggtgacgagggg
atcccgggtgagccaggtttgcctggaaaagcaggtgaacgtggcctccggggggcacct
gggcctcgggggcctgtgggtgagaagggggaccagggagatcctggagaagacggacgg
aatggcagccctggatcatctggacccaagggtgaccgtggggagcctggtcccccaggt
ccccctggacggctggtggatgcaggcattgaatccagagacaagggagagcctggacaa
gaaggtccccgaggacccaagggtgaccctgggccccctggagtctctggagaaaggggc
attgatgggcttcggggacccccaggcccacagggagaccccggtgttcgaggcccagca
ggagacaagggtgatcggggacccccagggctggatggccggagtgggctggatgggaaa
cccggagcccctggccccccagggctacatggtgcttcaggcaaagctggggacccgggg
agagatggacttccaggccttcgaggagaacatggcccccctggtccccctggccctcct
ggagttccgggaaaggcaggcgatgatggcaaaccaggcctgaatgggaaaaacggagac
cctggagaccctggagaagatggaaggaagggagaaaagggagattcgggtgcccctgga
agagaaggccctgatggccccaagggtgaacgtggagctcctggcaatcctggactccag
ggtcctccgggtctcccagggcaggtcggtcctcccggccagggtttccctggtgtccca
ggaattacgggtcctaagggtgaccgtggagagactggatccaaaggggaacagggcctt
cctggagaacgtggcctacgaggagaacctgggagcttgccaaacgcggagcgtttgctg
gaaactgctggcatcaaggtgtcggccctgcgggagatcgtggacacctgggatgagagt
tctggcagcttcctaccggtgcctgagcggagacctggccccaagggggaccctggtgac
cgaggccctccaggcaaggagggcctcatcggctttcctggagaacgtggactgaaggga
gagcgtggagaccctggccctcaggggcctcctggcctggccctgggtgagaggggccca
cctggcccacccggccttgcgggggaacccggaaagcctggcattcctggactcccaggc
cgggctggtggttcaggggaagcaggaaggccaggagagaggggagaaaggggagagaaa
ggagaacgcggggatcagggcagagatggccttcccggcctccctggaccacctggccct
cctggccccaaggtggccattgaagagccaggccctggactggctagagagcaaggacct
cctggactcaagggtgccaagggggagccaggcagtgatggtgaccctggacctaaagga
gacaggggtgtaccaggcatcaaaggcgatgtgggagagcctggaaagaggggtcatgat
ggcaacccaggtctcccgggagagcgtggtgtggctgggcctgaagggaagccgggtctt
cagggcccaagggggacccctggcccagtgggtagccatggagaccctggaccacctggt
gccccgggtcttgctggccctgcgggaccccaggggccttctggcctgaagggggagcct
ggagagacaggacctccaggacggggtctgcctggacctgttggagctgtgggactccct
ggccctcctggcccttccggcctcgtgggtccacaaggctctccaggtttgcccggacaa
gtgggggagacagggaagccaggacctccaggccgtgacggtagcagtggaaaggacgga
gatcggggaagtcctggtgtgccggggtcaccaggtctgcccggccctgttggacctaaa
ggagaacctgggcctgtgggggctcctggacaggtggtggtcgggccccctggagcaaaa
ggcgagaagggagccccgggagaccttgctggagccctgctgggtgagccgggagccaaa
ggtgaccgaggactgcctggaccacggggtgaaaagggtgaagctggccgtgcaggagga
cctggggaccctggggaagatggtcaaaaaggggctccaggactcaaaggtcttaagggt
gagccaggcattggggttcagggcccccctggcccaagtggtcctccaggtatgaaggga
gacttgggcccccctggtgcccccggggctcctggtgttgttgggttccctggtcagaca
ggacctcgaggagagacgggccagccagggcctgttggagagaggggtctggcaggccct
ccagggagagaaggtgccccaggtcccttgggaccacctggaccaccagggtcagcggga
gcacctggcgcctctggactcaaaggagacaagggagacccgggagcaggactgccgggg
ccccgaggtgagcgtggtgagccaggtgtccggggtgaagatggccaccctggccaggaa
ggacctcgtggacttgtggggccccctggcagccggggagagcaaggagagaagggcgct
gctggcgctgcagggctcaagggtgacaagggtgactcagctgtgattgagggacctccc
gggccacgaggtgccaaaggggatatgggtgaacgagggcctcggggcatagatggtgac
aaaggacctcggggagaaagtgggaatcctggtgacaagggttccaaaggagagccaggt
gacaaaggctcagctggatcgattggagttcgaggactcacaggacccaagggagagcca
ggtgctgcagggatccccggtgagccgggagccccaggaaaggatggaatccctggtttc
cgaggagacaaaggagatattggcttcatgggtcccaggggcctcaagggtgaaaaagga
ataaagggaacctgtggccgtgacggagagagaggagataagggagaagctggttttcct
ggtcgccctgggttggcaggaaagaaaggagacatgggggagcctggtctgccgggtcag
tctggggctcctgggaaagaaggcctgatcggtcccaagggtgacagaggctttgatggg
cagtcaggacccaagggtgaccaaggcgagaaaggggagagggggcctccaggagttggg
ggcttcccaggtcccagaggaaacgatggctctagtggtcccccagggccacctggtggt
gttggtcccaagggacccgaagggcttcagggtcagaagggtgagcgaggtccccctgga
gagagcgtggtgggggctcctggtgctcctggcacccctggagagagaggagagcaggga
cgaccaggacctgctggcccccgtggggagaagggagaagctgcgctgactgaggatgac
attcgggactttgtgcgtcaggagatgagtcagcactgtgcctgccagggccagtttatt
gcgtctggatcacgacccctccccggttatgctgcggatacagctggttcccagcttcac
catgttcctgtgctccgggtctctcatgttgaggaggaaggccaggtgccccctgaagat
gacgatgacttctctgagtactctgtgtattctgtggaggactaccaggagcctgaagtt
ccatgggatggtgaagccgagattaagggctgggaccagagaggttcagatctctgctcc
ctacccttggatgagggctcctgtactgcctataccctgcgctggtaccatcgagctgtg
cctggtggcacagcctgtcatccctttgtctatggtggctgcggagggaatgccaatcgt
tttggaacccgtgaggcgtgtgagcgccgctgcccaccccaaggggtccacagccagaaa
acaggtgctgcctag

DBGET integrated database retrieval system