KEGG   Mus musculus (mouse): 12837Help
Entry
12837             CDS       T01002                                 

Gene name
Col8a1, Col8a-1
Definition
(RefSeq) collagen, type VIII, alpha 1
  KO
K23455  collagen, type VIII, alpha
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    12837 (Col8a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen C1q BclA_C
Motif
Other DBs
NCBI-GeneID: 12837
NCBI-ProteinID: NP_031765
MGI: 88463
Ensembl: ENSMUSG00000068196
Vega: OTTMUSG00000021291
UniProt: Q00780
Structure
PDB: 

Position
16; 16 C1.1
AA seq 744 aa AA seqDB search
MAVPPRPLQLLGILFIISLNSVRLIQAGAYYGIKPLPPQIPPQIPPQIPQYQPLGQQVPH
MPLGKDGLSMGKEMPHMQYGKEYPHLPQYMKEIPPVPRMGKEVVPKKGKGEVPLASLRGE
QGPRGEPGPRGPPGPPGLPGHGMPGIKGKPGPQGYPGIGKPGMPGMPGKPGAMGMPGAKG
EIGPKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGAKGERGPKGPPGPPGLQGP
KGEKGFGMPGLPGLKGPPGMHGPPGPVGLPGVGKPGVTGFPGPQGPLGKPGPPGEPGPQG
LIGVPGVQGPPGMPGVGKPGQDGIPGQPGFPGGKGEQGLPGLPGPPGLPGVGKPGFPGPK
GDRGIGGVPGVLGPRGEKGPIGAPGMGGPPGEPGLPGIPGPMGPPGAIGFPGPKGEGGVV
GPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEGGHKGLPGLPGVPGLL
GPKGEPGIPGDQGLQGPPGIPGIVGPSGPIGPPGIPGPKGEPGLPGPPGFPGVGKPGVAG
LHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPTPSPQGEYLPDMGLGIDGVKPPHA
YAGKKGKHGGPAYEMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGV
YYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPS
EQAAGLYAGQYVHSSFSGYLLYPM
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccacccaggcctctacagctgctgggaatactgttcatcatttccctgaac
tctgtcagactcattcaggccggtgcctactatggaatcaagcctctgccacctcaaatc
cctcctcagataccaccacaaattccacagtaccagcccttgggccagcaagtccctcac
atgcctttgggcaaagatggcctttccatgggcaaggagatgcctcacatgcagtatggc
aaagagtacccacacctaccccaatatatgaaggaaatcccacctgtgccaagaatgggc
aaggaagtggtgcccaaaaaaggcaaaggagaagtaccgttagccagtttgcgcggagaa
caaggtccccgtggagaacctggaccaagaggaccacctgggccgccaggtttaccaggt
catggaatgcctggaatcaaaggaaaaccagggccccagggatatccaggaattggaaag
cccggtatgcctggaatgcctgggaagccaggagccatgggaatgccaggggcaaaaggc
gaaattggacccaaaggggaaatcggacctatgggaatcccagggccacaagggcctcca
ggacctcatggacttcctggcatcgggaaaccgggtgggccagggttaccagggcaacca
ggagcaaaaggtgagagggggcccaaaggaccaccaggacctcccggccttcagggtccc
aaaggagagaagggcttcgggatgcctggcttgccaggtctgaagggtcctccaggtatg
catggccctcctggaccagttggactaccgggagtaggaaaaccaggagtgacaggcttt
cctggaccacagggtcccctggggaagccagggcctccaggggaacctggaccacaaggc
cttattggtgtgccaggagttcaaggacctcctgggatgcctggagttggaaagccaggt
caggatgggatcccgggccaaccaggatttccgggtggtaaaggggaacaaggattgcca
gggttgcctggacccccaggcctcccaggggtcggaaagccaggtttcccaggacccaaa
ggggaccggggtattgggggtgttcctggggttcttgggccgagaggggaaaaaggaccc
attggtgctcctggaatggggggtccacctggagagccaggcctacccggtatcccgggt
cccatgggccctccaggtgctattggtttccctggacccaaaggagaaggtggagttgta
ggaccacagggtccaccaggccccaagggagagcctggcctccaaggcttccctgggaag
ccaggttttcttggtgaagtaggtccccctggcatgaggggtttgcctggtcctatagga
cccaagggagaaggtggtcacaaagggttgccagggcttcccggtgttccagggctgctt
ggacccaaaggagaacctggcatacctggggatcagggtctacagggtcccccagggatt
ccagggatcgtaggacctagtggccctattggaccccctgggattccgggccccaaagga
gaaccaggcctcccagggccccctgggttccctggtgtagggaagccaggagtagcagga
cttcatgggcccccggggaaacctggtgcccttgggcctcaaggccagcctggccttcct
ggacccccaggtcctccaggacccccaggccctccagctgtgatgcctacaccatcaccc
cagggagagtatctgccagatatgggactaggaattgatggggtgaaacctccgcatgcc
tatgcgggcaaaaagggcaaacacggagggccagcctatgagatgcctgcgtttactgcc
gagctgactgtacctttcccaccggtgggggccccagtgaagtttgacaagctgctctac
aacggcagacagaactacaatccgcagacaggcatcttcacctgtgaagtcccgggtgtc
tactactttgcttatcatgttcactgcaagggaggcaacgtatgggttgctctcttcaag
aacaacgagcccatgatgtacacatacgacgagtacaagaagggctttctggaccaagca
tctggaagcgcagtactgcttctccgtcccggagaccaggtgtttctccaaatgccttca
gaacaggctgctggactctatgccgggcaatatgtccactcctccttttcaggatattta
ttgtatcccatgtaa

DBGET integrated database retrieval system