KEGG   Mus musculus (mouse): 12839
Entry
12839             CDS       T01002                                 

Symbol
Col9a1, Col9a-1
Name
(RefSeq) collagen, type IX, alpha 1
  KO
K08131  collagen type IX alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12839 (Col9a1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12839 (Col9a1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12839 (Col9a1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12839 (Col9a1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12839 (Col9a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12839 (Col9a1)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Others
   12839 (Col9a1)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 12839
NCBI-ProteinID: NP_031766
MGI: 88465
Ensembl: ENSMUSG00000026147
Vega: OTTMUSG00000022796
UniProt: Q05722 Q8CEP0 Q8BSQ4 G3X995 Q9CT83
Position
1:24216670..24291819
AA seq 921 aa
MKNFWKISVFFCVCSCLGPWVSATLKRRARFPANSISNGGSELCPKIRIGQDDLPGFDLI
SQFQIEKAASRRTIQRVVGSTALQVAYKLGSNVDFRIPTRHLYPSGLPEEYSFLTTFRMT
GSTLEKHWNIWQIQDSAGREQVGVKINGQTKSVAFSYKGLDGSLQTAAFLNLPSLFDSRW
HKLMIGVERTSATLFIDCIRIESLPIKPRGQIDADGFAVLGKLVDNPQVSVPFELQWMLI
HCDPLRPRRETCHELPIRITTSQTTDERGPPGEQGPPGPPGPPGVPGIDGIDGDRGPKGP
PGPPGPPGDPGKPGAPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGVPGSRGFPGRGIP
GPPGPPGTTGLPGELGRVGPIGDPGKRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRS
GYPGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGELGEVGDQGPPGPQGLRGITGIVGDK
GEKGARGFDGEPGPQGIPGAAGDQGQRGPPGETGPEGDRGIQGSRGIPGSPGPKGDTGLP
GVDGRDGIPGMPGTKGEAGKPGPPGDVGLQGLPGVPGIPGAKGVAGEKGNTGAPGKPGQL
GSSGKPGQQGPPGEVGPRGPRGLPGSRGPVGPEGSPGIPGKLGSVGSPGLPGLPGPPGLP
GMKGDRGVFGEPGPKGEQGASGEEGEAGARGDLGDMGQPGPKGSVGNPGEPGLRGPEGIR
GLPGVEGPRGPPGPRGMQGDQGATGLPGIQGPPGRAPTDQHIKQVCMRVVQEHFAEMAAS
LKRPDTGASGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEK
GERGPPGRGPKGLPGAIGLPGDPGPASYGKNGRDGEQGPPGVAGIPGVPGPPGPPGPPGF
CEPASCTLQSGQRAFSKGPDK
NT seq 2766 nt   +upstreamnt  +downstreamnt
atgaagaacttctggaaaatctcagttttcttctgtgtgtgcagttgtctgggaccctgg
gtatccgcaactcttaagcgtcgtgcaagatttcctgccaattccatttctaatggtgga
agtgaactgtgtcccaagatcaggattggccaagatgacttaccagggtttgacctgatt
tctcagttccaaattgagaaggctgcatctcgaaggactatccagagggtggtgggatcc
acagccttacaagtggcttacaagctgggaagtaatgtagacttcaggattccaacaagg
catttgtatcccagtggactgcctgaagaatattcctttttaactactttccggatgact
ggaagcacacttgaaaagcactggaacatttggcagatccaggattccgcagggagagag
caagttggcgtgaagataaatggccaaacaaagtctgtcgcattttcatacaagggactg
gatgggagtctccaaacggctgccttcttgaatttgccgtccttgtttgactcccggtgg
cataagctcatgattggcgtggaaagaacaagcgccactctttttattgactgcatcagg
atcgaatctttacctataaagccaagaggccagattgatgcggatggctttgcagtgctg
ggaaaacttgtggacaatcctcaggtttctgttccttttgaactccagtggatgctgatt
cattgtgaccccctgagacccaggagagaaacctgtcatgagctgccaatcagaatcaca
accagccagaccactgatgagagaggtcctccgggtgagcaggggcctccagggcctcct
gggcctcctggagttccgggcatagatggcattgatggtgaccgaggtccaaagggtccc
ccaggacctccgggtcctcctggagacccaggcaagccaggagcaccaggcaagccaggc
acaccaggagctgatggattaacaggacctgatggatcccctggctctgttggaccaagg
ggacaaaaaggagaacctggtgtacctgggtctcgtggatttccaggccgtggtattcca
ggaccccctggtcctcctgggaccacaggacttcctggagaacttggccgagtaggccct
attggagaccctgggaaaagaggaccacctggccctcctggacctccaggacccagtgga
acaattggatttcatgatggagacccattgtgccccaattcctgcccaccaggtcgctct
ggatatccaggcctaccaggcatgaggggccataaaggggcgaaaggagaaatcggcgag
ccaggaagacaaggacacaagggtgaagagggtgaccagggggaactgggagaagttggc
gatcaaggacctccaggacctcagggtctgagaggcatcactggcatagttggagacaaa
ggagaaaagggtgctcggggatttgatggagagcctggacctcagggcattccaggtgca
gctggtgatcaaggacagcgaggccctccaggagaaacaggtcctgagggagacagaggc
attcaaggttcccgaggaattcctggatccccagggccaaaaggagacacgggcttgcca
ggtgtagatggccgagatggaataccaggaatgcccgggacaaagggtgaagcagggaag
cctggaccccccggggacgtgggattgcagggcttaccaggtgtccctggaatccctggt
gcaaaaggtgttgccggtgaaaagggtaacacgggtgctccaggaaagcccggtcagttg
ggaagttcagggaaaccaggccaacaagggcccccaggagaggttggacctcggggaccc
aggggccttccaggcagtagaggcccggtaggaccagaagggtctccaggcataccaggg
aaactgggatctgttggcagccctggccttcctggcttgcctgggccccctggacttcct
ggaatgaaaggagacaggggtgtatttggtgaaccgggtcccaagggtgaacagggtgcc
tctggtgaagaaggtgaagcaggagcaaggggtgaccttggagatatgggacaacctggc
ccaaagggatctgtgggtaaccccggggagccgggtctgagggggcctgaaggaatcaga
gggcttcctggagtggaaggaccaagaggaccacctggaccccggggcatgcagggagat
cagggtgccactgggctgcctggtatccagggccctccgggcagagcgccgaccgaccag
cacatcaagcaggtttgcatgagagtcgtgcaagagcattttgcggaaatggcagccagc
ctcaagagaccagacacaggagcctctggtcttcctgggaggcctggcccccctgggcct
ccgggcccccctggagagaatggtttccctggtcagatgggaatccgtggtctcccaggc
attaagggtccccctggtgctcttggcttaagaggacctaaaggagacttgggagaaaaa
ggagaacgtggtcctccaggaagaggtcctaagggtttgcctggagcgataggtctccca
ggtgacccaggccctgccagctatgggaaaaatggccgtgacggagagcaaggtcccccg
ggagtggcaggaattcctggtgtgcctggacccccaggtcctccaggccctcctgggttc
tgtgagccagcctcttgcaccctgcagtctggtcaaagagcatttagcaaagggccggac
aagtga

DBGET integrated database retrieval system