KEGG   Mus musculus (mouse): 12841Help
Entry
12841             CDS       T01002                                 

Gene name
Col9a3, AV006866
Definition
(RefSeq) collagen, type IX, alpha 3
  KO
K08131  collagen, type IX, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04974  Protein digestion and absorption
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12841 (Col9a3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12841 (Col9a3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12841 (Col9a3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    12841 (Col9a3)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    12841 (Col9a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    12841 (Col9a3)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   12841 (Col9a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 12841
NCBI-ProteinID: NP_034066
MGI: 894686
Ensembl: ENSMUSG00000027570
Vega: OTTMUSG00000016344
UniProt: A2ACT7 Q8BSX1
Position
2 H4; 2 103.14 cM
AA seq 680 aa AA seqDB search
MTGAPALALLLLGQLLTATSAQKVGPRGPPGPQGPPGKPGKDGIDGEAGPPGLPGLPGPK
GTSGKPGKPGEAGLPGLPGVDGLTGRDGPAGPKGAPGERGSLGPPGPPGLGGKGLPGPPG
EAGVSGLPGGIGLRGPPGPSGLPGLPGLPGPPGPPGNPGVLPEGATDLQCPAICPPGPPG
PPGMPGFKGPTGYKGEQGEVGKDGEKGSPGPPGPPGIPGTVGLQGPRGLRGLPGPLGPPG
DRGPIGFRGPPGTPGAPGKVGDRGERGPEGFRGPKGDLGRPGPKGIPGMAGPGGEPGMPG
KDGKDGVPGLDGEKGEAGRNGGQGEKGPNGLPGLPGRAGSKGEKGEPGRTGELGEAGPSG
EPGIPGDVGVPGERGEAGHRGSVGALGPQGPPGAPGIRGFQGQKGSTGDPGLPGPQGLRG
DVGDRGPGGATGPKGDQGIAGSDGLPGDKGELGPNGPVGQKGESGSRGELGPKGIQGPNG
TSGVQGVPGPPGPLGLQGVQGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHL
RKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGSQGDRGDK
GATGAGLDGPAGDQGYQGPQGVPGISKDGRDGAHGEPGLPGDPGLPGAAGAQGTPGICDT
SACQGAVLGGGGEKSGPRSS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagcgcctgccctagccctgctgctgctggggcagctcctgacggccacctcc
gcgcagaaagtgggaccccgaggcccccctggtccccaagggcctcctggaaaacccggc
aaggatggcattgatggagaagctggccctccaggtctgcctggccttccaggacccaaa
gggacctcagggaagccagggaagccgggagaggcaggactgccaggactgcctggtgta
gatggtctgacagggagagatggacccgcaggacccaaaggtgcccctggagaacgggga
agtctaggacccccagggccaccaggacttgggggcaaaggcctccctggacctcctgga
gaggcaggagtgagtggcctcccaggtgggattggtctacgtggccccccgggaccctct
ggacttccaggactgcctggcctcccaggacctcctggacctcctggaaaccctggagtc
ctccctgaaggtgctactgatctgcagtgtcccgccatctgcccgccaggccctccggga
cccccaggaatgccggggttcaaggggcctactggctacaaaggggaacaaggagaagtt
ggcaaagatggtgagaagggtagtcctggcccccccgggcctcctggaatcccaggcacc
gtggggctacagggcccacgaggattaagaggacttccagggccactcgggccccctggg
gaccggggtcccattgggtttcggggcccccctgggaccccaggagcacctgggaaagtg
ggtgacaggggtgaaaggggaccagaagggttccgtggccctaagggtgacctgggcagg
cctggtcccaaaggaatccctggaatggctgggccaggcggagaaccaggcatgccaggc
aaggatggcaaagatggtgtgccgggacttgatggtgagaagggagaggctggtcgcaat
ggtggccaaggagagaaaggccccaatgggctgccggggctccctggacgagcagggtcc
aaaggcgagaagggagaaccgggtagaactggcgagctgggtgaggctggcccctctgga
gagccaggtatccctggagatgttggtgttccaggggagcgtggtgaggctggtcacagg
ggctccgtgggagctcttggcccacaaggtcctcctggtgctcctggcatccgtggcttt
cagggacaaaaaggcagcacaggagaccctggccttccgggcccccaaggcctacgggga
gatgtgggtgaccggggtccaggaggtgccacaggccctaagggagaccagggcattgca
ggttccgatggtcttccaggggacaaaggcgagctgggtcctaatggccccgttggacaa
aaaggagagtctggcagccgaggggaactgggccccaaaggcatccagggccccaatggc
accagtggagtccagggtgtacctggtcccccaggtccactgggcctccaaggtgtgcag
ggtgtcccaggcatcaccgggaagcctggagttccgggcaaggaagccagtgaacagcgc
atcagggagctatgcgggggtatgatcagtgagcaaattgcacagttggctgcacacctg
aggaagcccttagcaccaggctccatcggcaggcctggtccagctggccccccaggccct
ccaggccctccaggctctattggccaccctggcgctcggggtccccctggataccgtggt
cccactggggaactaggagatcctggaccaagagggagccagggtgacagaggggacaag
ggagcaacaggtgcagggctggatgggcctgctggggaccagggctaccaagggcctcaa
ggtgtacctggcatcagcaaagatggtcgagatggtgctcatggtgagcctggccttccc
ggtgatcctggccttcctggagctgctggtgctcagggtaccccagggatctgcgacact
tcagcctgccaaggagctgtgttagggggaggtggggaaaagtcgggtcctcggagctca
taa

DBGET integrated database retrieval system