KEGG   Mus musculus (mouse): 12843Help
Entry
12843             CDS       T01002                                 

Gene name
Col1a2, AA960264, AI325291, Col1a-2, Cola-2, Cola2, oim
Definition
(RefSeq) collagen, type I, alpha 2
  KO
K06236  collagen, type I, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04974  Protein digestion and absorption
mmu05146  Amoebiasis
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12843 (Col1a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12843 (Col1a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12843 (Col1a2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12843 (Col1a2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    12843 (Col1a2)
  09154 Digestive system
   04974 Protein digestion and absorption
    12843 (Col1a2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    12843 (Col1a2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    12843 (Col1a2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12843 (Col1a2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12843 (Col1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12843 (Col1a2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   12843 (Col1a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI
Motif
Other DBs
NCBI-GeneID: 12843
NCBI-ProteinID: NP_031769
MGI: 88468
Ensembl: ENSMUSG00000029661
Vega: OTTMUSG00000021300
UniProt: Q01149 Q3TX57
Position
6 A1; 6 1.81 cM
AA seq 1372 aa AA seqDB search
MLSFVDTRTLLLLAVTSCLATCQYLQSGSVRKGPTGDRGPRGQRGPAGPRGRDGVDGPMG
PPGPPGSPGPPGSPAPPGLTGNFAAQYSDKGVSSGPGPMGLMGPRGPPGAVGAPGPQGFQ
GPAGEPGEPGQTGPAGPRGPAGSPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLP
GFKGVKGHSGMDGLKGQPGAQGVKGEPGAPGENGTPGQAGARGLPGERGRVGAPGPAGAR
GSDGSVGPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPV
GPPGNPGTNGLTGAKGATGLPGVAGAPGLPGPRGIPGPAGAAGATGARGLVGEPGPAGSK
GESGNKGEPGSVGAQGPPGPSGEEGKRGSPGEAGSAGPAGPPGLRGSPGSRGLPGADGRA
GVMGPPGNRGSTGPAGIRGPNGDAGRPGEPGLMGPRGLPGSPGNVGPSGKEGPVGLPGID
GRPGPIGPAGPRGEAGNIGFPGPKGPSGDPGKPGERGHPGLAGARGAPGPDGNNGAQGPP
GPQGVQGGKGEQGPAGPPGFQGLPGPSGTTGEVGKPGERGLPGEFGLPGPAGPRGERGTP
GESGAAGPSGPIGSRGPSGAPGPDGNKGEAGAVGAPGSAGASGPGGLPGERGAAGIPGGK
GEKGETGLRGDTGNTGRDGARGIPGAVGAPGPAGASGDRGEAGAAGPSGPAGPRGSPGER
GEVGPAGPNGFAGPAGAAGQPGAKGEKGTKGPKGENGIVGPTGSVGAAGPSGPNGPPGPV
GSRGDGGPPGMTGFPGAAGRTGPPGPSGIAGPPGPPGAAGKEGIRGPRGDQGPVGRTGET
GASGPPGFVGEKGPSGEPGTAGAPGTAGPQGLLGAPGILGLPGSRGERGLPGIAGALGEP
GPLGISGPPGARGPPGAVGSPGVNGAPGEAGRDGNPGSDGPPGRDGQPGHKGERGYPGSI
GPTGAAGAPGPHGSVGPAGKHGNRGEPGPAGSVGPVGAVGPRGPSGPQGIRGDKGEPGDK
GHRGLPGLKGYSGLQGLPGLAGLHGDQGAPGPVGPAGPRGPAGPSGPVGKDGRSGQPGPV
GPAGVRGSQGSQGPAGPPGPPGPPGPPGVSGGGYDFGFEGDFYRADQPRSQPSLRPKDYE
VDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWNSDYYWIDPNQGCTMDAIKVY
CDFSTGETCIQAQPVNTPAKNSYSRAQANKHVWLGETINGGSQFEYNVEGVSSKEMATQL
AFMRLLANRASQNITYHCKNSIAYLDEETGSLNKAVLLQGSNDVELVAEGNSRFTYSVLV
DGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFRVEVGPVCFK
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactctgttgctgcttgcagtaacttcgtgcctagca
acatgccaatatttgcaatcgggatcagtacgaaagggccccactggagacagaggacca
cgtggacaaaggggtcccgcaggtccccgaggcagagatggtgttgatggtcccatgggc
cctcctggtccccctggctcccctggtcctcccggctcccctgccccccctggtcttact
gggaactttgctgctcagtattctgacaaaggagtttcatctggccctggaccaatgggt
ttaatgggacccagaggccctcctggtgctgttggagcccctggccctcaaggtttccaa
ggacctgctggtgaacctggtgagcctggtcaaacgggtcctgcaggtccccgtggtcca
gctggctctcctggcaaggctggtgaggatggtcaccctggaaaacccggaagacctggg
gagagaggagtcgttggaccacagggtgctcgtggtttccccgggactcctggacttcct
ggcttcaaaggcgtgaaaggacacagtggtatggatggattaaagggacagcctggtgca
cagggtgtgaagggtgaacccggtgcccctggagagaatggaactccaggtcaagcagga
gcccgagggcttcctggtgagagagggcgtgtcggagctcctggtccagctggtgcccga
ggcagtgatggaagcgttggccccgtcggccctgctggtcccattgggtctgctggaccc
cctggtttcccaggtgctcctggtcccaagggtgaacttgggcccgttggtaaccctggc
cctgctggtcctgctggtccccgtggtgaagtgggtcttccaggtctttctggccctgtt
ggacctcctggcaaccctggaacaaatgggctcactggcgccaagggtgctactggactc
cctggtgtcgctggggctcccggtctccctggcccccgtggtattcctggccccgctggt
gctgctggtgctacaggtgccagaggacttgttggtgagcctggtcctgctggctccaaa
ggagaatccggtaacaagggtgagcctggctctgttggagcccaaggtcctcctggtccc
agcggtgaagaaggaaagagagggtctcccggagaagctggatctgctggccctgcaggg
cctccagggcttagaggcagccctggttctcgaggtcttcctggagctgatggcagagct
ggtgtaatgggtcctcctggcaatcgtggttcaaccggccctgctggaatccgaggtcct
aatggagatgccggtcgacctggggaacctggtctcatgggacccagaggtcttcctggg
tctcctggaaatgttggcccatctggtaaagaaggccctgtgggtctccctggcattgat
ggcagacctggcccaatcggcccagctggaccaagaggtgaagctggcaacatcggattc
cctggacccaaaggcccctctggtgatcctggcaaacctggtgagagaggacaccccggt
cttgctggtgctcggggagctccaggacccgatggcaacaatggagctcagggcccccct
ggaccccagggtgttcaaggtggcaaaggtgaacaaggccctgctggtcctcctggcttc
cagggtctccctggtccctcaggtactactggagaagttggcaagcccggagaaaggggt
cttcctggtgaattcggtctccctggtcctgctggtccaagaggagaacgtggtaccccg
ggtgagagtggagctgctggcccttctggtcctattggaagccgaggtcccagtggagcc
ccagggcctgatggaaacaagggtgaagctggtgcagtcggtgctccaggcagtgctggt
gcctctgggcctggtgggcttccaggagagaggggtgctgctggcatacctgggggcaaa
ggagaaaagggtgaaactggtctccgaggtgacactggcaacactggtagagatggtgct
cgtggcattcctggtgctgtaggtgcccctggtcctgctggggcctcaggtgaccggggt
gaagctggtgctgccggtccttctggcccagctggtcctcggggtagccctggtgaacgt
ggtgaagttggccctgctggccccaatggatttgctggtcctgctggtgctgctggccaa
cccggtgctaaaggagagaagggaaccaaagggcctaagggtgaaaatggcattgttggt
ccaaccgggtctgttggagctgctggcccatctggtcctaatggcccacctggtcctgtt
ggaagtcgtggtgatggagggccccctggtatgactggcttccctggtgctgctggacgg
actggtccccccggacccagtggtattgctggcccccctggcccccctggtgctgctgga
aaggaagggattcgtggtccccgtggcgaccaaggtccagttggccgaactggagaaaca
ggtgcatctggaccccctggatttgttggtgaaaagggtccctctggagaacctggtacc
gcaggagcccctggtaccgcaggtcctcagggtcttcttggtgctcccggtattctgggt
ctccctggctctagaggtgaacgtggtctgccaggtattgctggtgctctgggtgaacct
ggtcctctgggcatctcaggccctcctggtgcccgtggtccccctggtgctgtgggcagc
cctggagttaatggtgcccctggtgaagctggtcgtgatggtaaccctggcagcgatggt
cccccaggtcgtgatggtcagcctggacacaagggagagcgtggttaccctggcagcatt
ggtccgactggtgctgcaggtgcccctggtcctcacggttctgtgggtcctgctgggaaa
catggaaaccgaggtgaacctggtcctgccggttctgttggtcctgttggtgctgttggt
ccaagaggtcctagtggtcctcaaggcatccgaggtgacaaaggagaacctggtgataaa
gggcacaggggtcttcctggcttaaaaggatacagtggattgcagggtcttcctggtctt
gctggcctacatggtgaccaaggagctcctggtcctgtgggtcctgctggtcccaggggt
cctgctgggccttctggacccgttggcaaagatggtagatctgggcaacctggcccagtc
gggcctgctggtgttcgtggttctcagggtagccaaggtcccgctggtccccctggtccc
cctggacctcctggtcctcctggtgtcagcggaggtggctatgactttggttttgaagga
gacttctacagggctgaccagcctcgctcccagccttcactcagacccaaggactatgaa
gttgatgcaactctgaaatctctcaataaccagattgagacccttctcactcctgaaggc
tctagaaagaaccctgctcgcacgtgccgggacttaagactcagccacccagagtggaac
agcgattactactggattgaccctaaccaaggatgtactatggatgccatcaaagtgtac
tgtgatttctctactggtgaaacctgcatccaggcccaacctgtaaacaccccagcgaag
aactcatacagccgcgcccaggccaacaagcatgtctggttaggagagactatcaatggt
ggcagccagtttgaatacaacgtagaaggggtgtcctccaaggaaatggcaactcagctc
gccttcatgcgcctgctagccaaccgtgcttctcagaacatcacctaccactgcaagaac
agcattgcgtacctggatgaggagacgggcagcttgaacaaggctgtgcttctgcagggt
tccaacgatgttgaacttgttgctgagggcaacagcaggttcacctactctgtcctagtc
gatggctgctccaaaaagacaaatgaatggggcaagacaatcattgaatacaaaacaaat
aagccatctcgcctgccgttccttgacattgcacctctggacattggtggtgctgaccaa
gaattccgtgtggaggttggccccgtctgtttcaaataa

DBGET integrated database retrieval system