KEGG   Mus musculus (mouse): 12845
Entry
12845             CDS       T01002                                 

Gene name
Comp, TS, TSP5
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12845 (Comp)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    12845 (Comp)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12845 (Comp)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12845 (Comp)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    12845 (Comp)
  09174 Infectious disease: parasitic
   05144 Malaria
    12845 (Comp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12845 (Comp)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12845 (Comp)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12845 (Comp)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12845 (Comp)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12845 (Comp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12845 (Comp)
  Exosomal proteins of colorectal cancer cells
   12845 (Comp)
  Exosomal proteins of bladder cancer cells
   12845 (Comp)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   12845 (Comp)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   12845 (Comp)
SSDB
Motif
Pfam: TSP_C TSP_3 EGF_CA COMP cEGF EGF_3 EGF_MSP1_1
Other DBs
NCBI-GeneID: 12845
NCBI-ProteinID: NP_057894
MGI: 88469
Ensembl: ENSMUSG00000031849
Vega: OTTMUSG00000062218
UniProt: Q9R0G6
Structure
PDB: 
1MZ9 3V2N 3V2P 3V2Q 3V2R

Position
8 B3.3; 8 34.15 cM
AA seq 755 aa
MGPTACVLVLALAILRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRQQVKEITF
LKNTVMECDACGMQPARTPGLSVRPVPLCAPGSCFPGVVCSETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKSNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQTSGCQRRGQHFCPDGSPSPCHEKAN
CVLERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDGIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDSDKWGDACDNCRSKKNDDQKDT
DLDGRGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYESHRLQRV
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgggccccactgcctgcgttctagtgctcgccctggctatcctgcgggcgacaggccag
ggccagatcccgctgggtggagacctggccccacagatgctgcgagaacttcaggagact
aatgcggcgctgcaagacgtgagagagctgttgcgacagcaggtcaaggagatcaccttc
ctgaagaatacggtgatggaatgtgatgcttgcggaatgcagcccgcacgcactccaggc
ctgagcgtgcggccagtgccgctctgcgcacccggctcctgcttccccggcgtagtctgc
tccgagacagctacgggcgcgcgctgcggcccctgccctcctggctacaccggcaacggc
tcgcactgcaccgacgttaatgagtgcaatgctcacccctgtttcccgcgggtgcggtgc
atcaataccagccctggctttcactgcgaagcctgtccccctgggttcagcggacccacc
cacgagggcgtgggactgaccttcgctaagtccaacaaacaagtttgcacggatattaat
gagtgtgagaccgggcagcacaattgcgttcccaactccgtgtgcgtcaacacccggggc
tccttccagtgcggcccctgccagcccggtttcgtgggcgaccagacgtcaggctgccag
cggcgtgggcagcacttctgccccgatgggtcacccagcccgtgccatgagaaagcaaac
tgcgtcctggagcgggatggctcgaggtcttgcgtgtgtgcagttggctgggccggcaac
gggctcctgtgcggccgcgacacggacctggacggttttcctgacgagaagcttcgctgc
tcagagcgccagtgtcgcaaggacaactgcgtgacggtgcccaattcggggcaggaggat
gtggaccgggacggcatcggagatgcttgtgacccggatgcggacggggatggagtccct
aacgagcaagacaattgcccgctggttcgaaacccagaccagcgtaactcggacagtgat
aagtggggagatgcctgcgacaactgccggtccaagaagaatgacgatcagaaagataca
gacctggatggccggggcgatgcctgcgacgacgacatagatggcgaccgaatacgaaat
gtagctgacaactgtccccgggtgcccaactttgaccagagtgacagtgatggtgatggt
gttggggatgcctgtgacaactgtccccagaaagataacccagaccagagggatgtggac
cacgactttgtgggtgatgcctgtgatagtgaccaagaccaggatggggatggtcaccag
gactcccgggacaactgccccacagtacccaacagtgcccagcaggactcagatcatgat
ggcaagggcgatgcctgtgatgacgatgatgacaatgacggagttcctgatagccgggac
aactgccgcttggtgcctaaccctggccaagaggacaatgaccgggatggcgtgggtgac
gcgtgtcagggtgacttcgatgctgacaaggttatagacaagatcgatgtgtgccccgag
aacgccgaggtcaccctcaccgacttcagggccttccagacggttgtgttggaccccgag
ggtgatgcgcagatcgatcccaactgggtggtgctcaatcagggaatggagatcgttcag
accatgaacagtgaccctggcctggctgtgggttacacagccttcaacggcgtggacttc
gagggcacattccatgtaaacaccgccactgatgatgactatgctggtttcatcttcggc
taccaagacagctccagtttctacgtagtcatgtggaaacagatggagcagacgtactgg
caggccaatcccttccgggctgtggctgagccagggattcagctcaaggctgtcaagtcc
tctacaggtcccggggaacagctccgaaacgcactgtggcacacgggggacacagcatcc
caggtgcggctgctgtggaaggatcctcgaaacgtgggctggaaggataaaacatcctac
cgctggttcctgcagcaccggcctcaagttggctacatcagggtgcggttctatgagggt
cctgagctagtagctgacagcaatgtggtgttggacacggccatgcgtggtggccgcctg
ggtgtcttctgcttctcccaagagaacatcatctgggctaacctgcgctaccgttgcaat
gatacaatccctgaggactacgagagtcaccggctgcagagagtctag

KEGG   Mus musculus (mouse): 21825
Entry
21825             CDS       T01002                                 

Gene name
Thbs1, TS, TSP, TSP-1, TSP1, Thbs-, Thbs-1, tbs, tbsp1
Definition
(RefSeq) thrombospondin 1
  KO
K16857  thrombospondin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04115  p53 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    21825 (Thbs1)
   04350 TGF-beta signaling pathway
    21825 (Thbs1)
   04151 PI3K-Akt signaling pathway
    21825 (Thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21825 (Thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21825 (Thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    21825 (Thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21825 (Thbs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    21825 (Thbs1)
   05205 Proteoglycans in cancer
    21825 (Thbs1)
  09162 Cancer: specific types
   05219 Bladder cancer
    21825 (Thbs1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21825 (Thbs1)
  09174 Infectious disease: parasitic
   05144 Malaria
    21825 (Thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21825 (Thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21825 (Thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21825 (Thbs1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21825 (Thbs1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21825 (Thbs1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21825 (Thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA Laminin_G_3 Laminin_G_2 TSP1_CCN EGF Laminin_G_1
Other DBs
NCBI-GeneID: 21825
NCBI-ProteinID: NP_001300843
MGI: 98737
Ensembl: ENSMUSG00000040152
Vega: OTTMUSG00000015240
UniProt: Q80YQ1 Q3TR40
Position
2 E5; 2 59.34 cM
AA seq 1170 aa
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFR
IENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNTGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRK
VTEENRELVSELKRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDKNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRQF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagctcctgcggggactaggtgtcctgttcctgttgcatatgtgtggaagcaaccgc
attccagagtctgggggagataacggtgtgtttgacatctttgaactcattggaggtgca
cgaaggggccccggtcgccgactggtgaagggccaagatctatccagccccgccttccgc
attgagaatgccaacctgatccccgctgtgccggatgacaagttccaagacctactggac
gctgtgtgggccgacaaaggcttcatcttcctggcttccttgaggcagatgaagaagacc
cggggcacactcctggctgtggaacggaaagacaacactggccagatcttcagtgtggtc
tccaacggcaaagctggcaccctggacctgagcctgagcctgccagggaagcaacaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtt
caagaggaccgggctcaactctacatagactgtgataagatggagagcgcggagctggat
gtacccatccagagcatcttcaccagggatctggccagcgttgccaggctccgagttgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagctctaccaacgtccttctt
acccttgacaacaacgtggtgaacggttccagccctgctatccgcaccaactacatcggc
cacaaaacaaaggacctccaagctatctgtggcctctcctgtgatgaactatccagcatg
gtcctggaactgaagggcctgcgcaccatcgtgaccactctgcaggacagcatccgaaaa
gtgacggaagagaacagagagctggtcagtgagctgaagcggcctcccctctgctttcac
aatggagtccagtacaagaacaacgaggagtggactgtagacagttgcacagagtgtcac
tgccagaactcggttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaac
gccacagttcctgatggtgaatgctgcccacggtgctggcccagcgactctgctgacgat
ggctggtctccctggtctgagtggacctcctgctctgccacatgtggcaatggaattcag
caacgtggtcgttcctgtgacagcctcaacaacagatgcgagggctcttcggtacagaca
aggacctgccacattcaggagtgtgacaaaagatttaaacaggatggtggctggagtcac
tggtctccatggtcgtcctgttctgtgacctgtggtgacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagcccgggag
accaaagcctgcaagaaagacgcctgcccaattaatggaggctggggtccctggtcacca
tgggacatctgctctgtcacctgtggaggaggagtgcagagacgcagccgactctgtaac
aaccccacaccccagtttggaggcaaagactgtgttggcgatgtgacagaaaatcaagtt
tgcaacaagcaggactgcccaattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtactagctaccctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggcatccagtgcaaagacgtcgatgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggagaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcactggctcacagcccttcggccgaggtgtcgaacatgccatggccaac
aaacaggtgtgcaaaccgcgaaacccctgcacggacgggacgcatgactgcaacaagaac
gctaagtgcaactacctgggtcactacagtgaccccatgtaccgctgtgagtgcaagccc
ggctatgcaggcaatggcatcatctgcggagaggacacagacctggacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgccccaac
cttcccaactcggggcaggaagactatgacaaggacgggattggcgatgcctgcgatgat
gacgatgacaacgacaagatccccgatgacagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaactgcccctacaac
cacaaccctgaccaagcagacacagacaaaaacggggagggcgatgcctgtgctgtggac
atcgatggagatggaatcctcaatgaacgagacaactgccagtacgtttacaacgtggac
cagagggacacggacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcagacctcataggggacacttgtgacaacaatcag
gacatcgatgaggatggccatcagaacaatctggacaactgtccctatgtgcctaatgcc
aaccaggccgaccatgataaagatggcaaaggagatgcctgtgaccatgacgatgacaat
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggtgacgcctgcaaagacgactttgaccatgacaatgtgcca
gatattgatgacatctgtcctgagaattttgacatcagtgaaaccgatttccgacaattc
cagatgattcctctagatcccaaaggaacctcccaaaatgaccctaactgggttgtccgc
catcagggcaaagaacttgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgctgtggacttcagcggtaccttcttcatcaacaccgagagagatgat
gactacgctggctttgttttcggctaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagggctcagggatactcaggc
ctgtctgtaaaggttgtgaactccaccaccggccctggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgccacatc
ggctggaaagatttcactgcatacagatggcgtctcagccacaggccaaagaccggttat
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcgggacccatctatgac
aaaacctacgccggcggtagactaggcctgttcgtcttctctcaggaaatggtgttcttc
tcagacatgaaatacgagtgtcgagattcctaa

KEGG   Mus musculus (mouse): 21826
Entry
21826             CDS       T01002                                 

Gene name
Thbs2, TS, TSP2, Thbs-, Thbs-2
Definition
(RefSeq) thrombospondin 2
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21826 (Thbs2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21826 (Thbs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21826 (Thbs2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21826 (Thbs2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21826 (Thbs2)
  09174 Infectious disease: parasitic
   05144 Malaria
    21826 (Thbs2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21826 (Thbs2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21826 (Thbs2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21826 (Thbs2)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21826 (Thbs2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21826 (Thbs2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21826 (Thbs2)
  Exosomal proteins of colorectal cancer cells
   21826 (Thbs2)
  Exosomal proteins of bladder cancer cells
   21826 (Thbs2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21826 (Thbs2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21826 (Thbs2)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS Laminin_G_3 EGF cEGF TSP1_CCN
Other DBs
NCBI-GeneID: 21826
NCBI-ProteinID: NP_035711
MGI: 98738
Ensembl: ENSMUSG00000023885
UniProt: Q03350
Position
17 A2; 17 8.95 cM
AA seq 1172 aa
MLWALALLALGIGPRASAGDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCHQITCSPATC
ANPSFVEGECCPSCSHSADSDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKPCQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDI
CFSTNKAPRCVNTNPGFHCLPCPPRYKGNQPFGVGLEDARTEKQVCEPENPCKDKTHSCH
KNAECIYLGHFSDPMYKCECQIGYAGDGLICGEDSDLDGWPNNNLVCATNATYHCIKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCQLLFNPRQLDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQIDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgctctgggcactggccctgctggctctgggcatagggccaagagcttctgctggtgac
cacgtcaaggacacttcatttgaccttttcagcatcagcaacattaaccggaagaccatc
ggtgccaagcagttccgagggcctgaccccggggtgcccgcctaccgttttgtacggttt
gactacatccccccagtgaacacagatgatctcaacaggattgtcaagcttgcaaggaga
aaggagggcttcttcctcacagcccaactgaagcaggaccgcaagtctcggggaacgctc
ctggtgttggaaggccccggcacctcccagaggcagtttgagattgtgtccaatggccca
ggggacactttggacctcaactactgggtagaaggcaatcagcataccaacttcctggag
gatgtgggcctggctgactcccagtggaagaatgtgactgtgcaggtggccagtgacacc
tatagcctgtatgtgggctgcgatcttatcgacagtgtcaccctggaagaaccattctat
gagcagctagaagtagacaggagcaggatgtacgtggccaaaggtgcatctcgagagagt
cacttcaggggcttgctgcagaatgtccatctcgtgtttgcagattctgtggaagatatc
ttaagcaagaaaggctgtcaacacagccagggagctgaagtcaacaccatcagtgaacat
acagagactctccatctgagccctcacatcaccacagatctcgtggtccagggtgtggag
aaggcacaggaggtgtgtacgcactcctgcgaggagttgagcaacatgatgaatgagctc
tctggactgcacgtcatggtgaaccagctgagcaagaacctggagagagtgtctagtgat
aaccagttccttttggagctcattgggggccctctgaagacaagaaacatgtcagcctgt
gtgcaggagggccgaatctttgcagaaaatgaaacctgggttgtggatagttgtaccaca
tgcacctgcaagaaatttaaaacagtctgccatcagatcacctgctcacctgcaacttgt
gccaacccatcttttgtggaaggcgagtgctgtccatcctgttcacactctgcagacagt
gatgagggctggtctccgtgggcagagtggaccgagtgttctgtcacctgtggctctggg
acccagcagagaggccggtcttgtgatgtcaccagcaacacctgcctgggcccctccatt
cagacaaggacatgcagcctgggcaaatgtgatacgagaatccgtcagaatggaggctgg
agtcactggtcaccctggtcttcatgctccgtgacttgtggagttggcaatgtcacccgc
atacgtctctgcaactcaccagtgccccagatgggtggcaagaactgcaagggcagcggc
cgggaaaccaaaccctgtcagcgtgatccgtgcccaattgatggccgctggagcccctgg
tccccttggtcagcctgcacagttacctgtgctggagggatccgtgagcgctcacgtgtt
tgcaacagccctgagccccagtatggagggaaggactgtgtcggggatgtgacagaacac
caaatgtgcaacaagagaagctgccctattgatgggtgcttatccaacccgtgttttcct
ggagccaagtgcaacagcttccctgatgggtcctggtcctgtggctcctgcccagtgggc
tttctgggcaatggtacccactgtgaggacctggatgagtgtgctgtggtcacagatatt
tgcttctcaactaacaaagctccccgctgtgtcaacaccaacccgggcttccactgcctg
ccttgtccaccacgctacaaggggaaccaacccttcggtgttggcctggaggatgctagg
acagaaaaacaagtgtgtgagccagagaatccatgtaaggacaagactcacagctgccac
aagaatgcagagtgcatctacctgggccactttagtgaccccatgtacaagtgtgagtgc
cagattggctacgcaggtgatgggctcatctgcggggaggactcagacctggatggctgg
cccaacaacaacctggtgtgtgctactaatgccacctaccactgcatcaaggacaactgc
cccaaactgccaaattccgggcaggaggattttgataaggatggaatcggagatgcttgt
gacgaggacgatgacaatgacggtgtgagcgatgagaaggacaattgccagcttctcttc
aatccccgtcaattagactatgacaaggatgaggttggagaccgctgtgacaactgcccc
tatgtgcacaacccagcacagatcgacacagacaacaatggcgagggggatgcctgctct
gtggacattgacggagacgatgttttcaatgagcgagacaattgtccatatgtctacaac
actgaccagagagatacggatggtgatggcgtgggtgaccactgtgacaattgtcctctg
atgcacaacccagatcagatcgatcaggacaatgatctcgttggagaccagtgtgacaac
aatgaggacatagatgatgacggccaccagaacaaccaagacaactgcccatacatctcc
aactccaaccaggctgaccatgacaacgacggcaagggcgatgcctgcgactctgatgat
gacaatgatggtgttccagatgacagggacaactgtcggcttgtgttcaacccagaccag
gaagactcggacggtgacggccgaggtgacatttgtaaagatgactttgacaatgataat
gtcccagatattgatgatgtgtgccctgagaacaatgccatcactgagacagacttcaga
aacttccagatggtccctctggatcccaaggggaccacacaaattgatcccaactgggta
attcgtcaccaaggcaaagagctggtgcagacagcaaactcagaccctggcatcgctgta
ggtttcgacgagtttgggtctgtggacttcagtggcactttctatgtcaacactgaccgg
gatgatgactacgctggctttgtctttggctatcagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacccagacctactgggaagacaagcccagtcgggcttacggctac
tctggtgtgtcactcaaagtggtaaactccacgactggtactggcgagcacctgaggaat
gccctgtggcacacgggaaacacagaaggccaggtccggactctatggcatgaccccaaa
aacattggctggaaagactacactgcctacaggtggcacctgattcacaggcctaagaca
ggctacatgagagtcttagtgcatgaaggaaagcaagtcatggctgactcaggaccaatt
tatgaccaaacctacgctggtggacggctgggcctgtttgtcttctcccaagagatggtc
tatttctcggacctcaagtatgagtgcagagatgcctag

KEGG   Mus musculus (mouse): 21827
Entry
21827             CDS       T01002                                 

Gene name
Thbs3, TS, TSP3, Thbs-, Thbs-3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21827 (Thbs3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21827 (Thbs3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21827 (Thbs3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21827 (Thbs3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21827 (Thbs3)
  09174 Infectious disease: parasitic
   05144 Malaria
    21827 (Thbs3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21827 (Thbs3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21827 (Thbs3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21827 (Thbs3)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21827 (Thbs3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21827 (Thbs3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21827 (Thbs3)
  Exosomal proteins of colorectal cancer cells
   21827 (Thbs3)
  Exosomal proteins of bladder cancer cells
   21827 (Thbs3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21827 (Thbs3)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21827 (Thbs3)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF
Other DBs
NCBI-GeneID: 21827
NCBI-ProteinID: NP_038719
MGI: 98739
Ensembl: ENSMUSG00000028047
Vega: OTTMUSG00000030357
UniProt: Q05895
Position
3 F1; 3 39.01 cM
AA seq 956 aa
MEKPELWGVLALLLLCSYTCGSQDLQVIDLLTVGESRQMVAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRM
QGFVESMKIILGGSMARVGALSECPFQGDDSIHNAVTSALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCDDINECAHADPCFPGSSCINTMPGFHCEACPPGYKGTRVSGVGIDY
ARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCVPARTCHS
PAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGVPDYIPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSISG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWRLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2871 nt   +upstreamnt  +downstreamnt
atggagaagccggaactttggggtgtcctggctctcctcctcctctgctcttacacgtgt
ggcagtcaggaccttcaggtaattgacctgctgacagtgggcgaatccaggcagatggta
gctgtggcagagaagattcggacagctttactcactgctggggatatctacctcttgtcc
actttccgcctccctccaaagcaaggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaagatcaacaaagtgctggtgcggtac
cagcgggaagatggcaaagtccatgcagtgaacctacagcaagcaggcctggctgatggg
cgcacacacacggctctcctgcgactccgaggaccttctcgacccagccctggcctgcag
ctgtatgtggactgtaaactgggtgaccaacatgctggccttccagcactggccccgatc
cctccagcagaggtcagtggactggagattagaactggacaaaaggcttatctgaggatg
cagggctttgtggaatcgatgaaaattattctgggtggatccatggctcgggtaggagcc
ctgagtgaatgtccattccaaggagacgactccattcacaatgcagtgaccagcgcactg
caatccattctaggggagcagaccaaggcattggtcacccagctcaccctcttcaaccag
atcctagtggagcttcgggacgacatccgagaccaggtgaaggaaatgtcactcatccgg
aacaccatcatggagtgtcaggtgtgcggtttccacgagcagcgttcacactgcagcccc
agcccctgcttccgaggcgtggactgtatggaagtgtatgagtacccgggctatcgctgt
gggccctgcccacctggcctgcagggcaatggcacccactgtgatgacatcaacgagtgt
gctcacgctgacccctgtttcccggggtccagctgcatcaacaccatgcctggcttccac
tgcgaggcctgtcctccagggtacaagggcacccgagtgtctggtgtgggcatcgactat
gctcgagccagcaaacaggtctgcaatgacattgatgaatgtaatgatggtaacaacgga
ggctgtgacccaaattccatctgcaccaacacggtggggtctttcaaatgtggtccctgc
cgcctgggtttcctggggaaccagagccagggctgcgttccagcaaggacctgccacagc
cctgcccacagcccctgccacatccacgcccactgtctctttgaacgcaatggcgctgtg
tcatgccagtgtaacgtgggctgggcagggaatgggaacgtgtgtgggcctgacacagat
atagacggctatccggaccaggctcttccctgcatggataacaacaagcactgcaagcag
gacaattgccttttgacacccaactctgggcaagaagatgctgataacgatggtgtcggg
gaccagtgtgatgacgatgctgacggggatggtatcaagaatgtggaggacaattgtcga
ctgttccccaacaaggaccagcagaattcagacacagactcgtttggtgatgcctgcgac
aactgtcccaatgttcccaacaatgaccagaaggacacggatggcaatggagaaggagat
gcctgtgacaacgatgtggacggggatggcatccccaacgggttggacaattgccctaaa
gtacccaacccactgcagacagaccgggatgaagacggagtgggagatgcttgcgacagc
tgccctgaaatgagcaatcctacccagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaacgaagacagcgacggagacgggcaccaggacaccaaggacaactgtcct
cagctgccaaatagctctcagctggactcagacaatgacgggcttggagatgagtgtgac
ggggacgatgacaatgacggtgtcccagattacattcctcccgggcctgataactgtcgc
ctggtacccaatcctaatcagaaggactcagatggcaacggtgtgggtgatgtctgtgaa
gatgactttgacaatgacgcagtggttgaccctctggatgtgtgcccggagagtgcagaa
gttaccctcacagacttccgggcctatcagactgtgatcctggatcccgagggtgacgcc
cagatcgatccaaactgggtagtgctcaaccagggcatggaaattgttcagactatgaac
agtgacccgggtcttgcagttgggtacacggcctttaatggcgtggactttgaaggcacc
ttccacgtgaacacagtcactgatgatgactatgcgggcttcctcttcagttaccaggac
agtggccgcttctatgtggtcatgtggaaacagacggagcagacctactggcaggccacg
cctttccgagcagtggcccaaccagggcttcagctcaaggcagtgacatccatatctggc
ccaggtgagcacctccggaatgctctgtggcatactggccacacccctgatcaggtacga
ctgctgtggactgacccacggaatgtgggttggcgagacaagacatcctatagatggcgg
ctgctccaccggccccaagttggctacattcgggtgaagctctatgagggtccccagcta
gtggcggattctggggtgattattgacacgtccatgcgaggggggcgtctcggcgtattc
tgcttctcccaagaaaacatcatttggtccaatctccagtaccgatgcaatgacacagtg
cctgaggactttgagccattccggaggcagctgctccagggaagagtgtga

KEGG   Mus musculus (mouse): 21828
Entry
21828             CDS       T01002                                 

Gene name
Thbs4, TS, TSP, TSP4
Definition
(RefSeq) thrombospondin 4
  KO
K04659  thrombospondin 2/3/4/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu05144  Malaria
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    21828 (Thbs4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    21828 (Thbs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    21828 (Thbs4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    21828 (Thbs4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21828 (Thbs4)
  09174 Infectious disease: parasitic
   05144 Malaria
    21828 (Thbs4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    21828 (Thbs4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    21828 (Thbs4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    21828 (Thbs4)
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    21828 (Thbs4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    21828 (Thbs4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   21828 (Thbs4)
  Exosomal proteins of colorectal cancer cells
   21828 (Thbs4)
  Exosomal proteins of bladder cancer cells
   21828 (Thbs4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   21828 (Thbs4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   21828 (Thbs4)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 EGF cEGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 21828
NCBI-ProteinID: NP_035712
MGI: 1101779
Ensembl: ENSMUSG00000021702
Vega: OTTMUSG00000036725
UniProt: Q9Z1T2 B2RTL6
Position
13 C3; 13 47.75 cM
AA seq 963 aa
MPAPRAAAAAFLLLHLVLQPWQRTSAQATPQVFDLLPSSSQRLNPSALQPVLTDPTLHEV
YLISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQ
LADGRRHRVLLRLSNLQRGDGSVELYLDCAQADSVRNLPRAFSGLTQNPESIELRTFQRK
PQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVK
DLLRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAPPAPPTRPTRHCDSSPCFRG
VRCTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPGVRCVNLAPGFRCDACPVGFT
GPMVQGVGINFAKTNKQVCTDVDECQNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGC
KTERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCS
ARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNIDQRNSDKDI
FGDACDNCRMVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRVPNRDQQDRDGDDV
GDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSSQLDTDKDG
IGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNNDGVGDICEADFDQDQVIDHIDV
CPENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNG
VDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKA
VKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRF
YEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQSFDR
LDN
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgccggccccacgcgcggccgcggccgccttcctcctgctgcacctggtcctgcagccg
tggcagcggacgagcgcccaggccacaccccaggtctttgatcttctaccgtcctccagc
cagaggctgaaccccagcgccctgcagccagtcctgacagatcccaccctgcacgaagtc
tatctcatctccaccttcaagctgcagagtaaaagctcagccaccatctttggcctctac
tcctcaagtgacaacagcaaatactttgaattcactgtgatgggacggctgaacaaagcc
atcctccgctacctgaagaatgatggaaagatccatctggtggtgttcaacaacttgcag
ctggctgatgggaggcgccacagggttctcctgagactgagcaatttgcagagaggagat
ggctctgtagaactctacctggactgcgctcaggcggactcggtgcgcaacctccccaga
gccttttctggcctcacccagaacccagagtccattgaattgcggacattccagaggaag
ccccaggacttcttggaagagctgaagctggtggtgcggggctcgctgttccaggtggcc
agcctccaagactgcttcctgcagcagagtgagcctctggctgccacaagcacaggagac
tttaatcgacagttcttgggtcaaatgacacaactgaaccagctccttggagaggtgaaa
gatcttctgaggcagcaggtcaaggaaacatcgtttttgcgaaacaccattgctgaatgc
caagcttgtggtcctctcagctttcagtccccaactccaaacacactggtgcccatagct
cctccagcacccccaactcgcccaacacgccactgtgactccagcccttgtttccgaggt
gtccgatgtacggacaccagggatggcttccagtgtggaccctgcccagatggttacacg
ggaaacgggatcacctgctctgacgtggatgagtgcaaataccatccctgctatccaggt
gtgcgctgtgtgaatttggctccgggtttcagatgtgacgcctgtccagtaggtttcaca
gggcccatggtgcagggtgtcgggatcaactttgctaaaacaaacaagcaggtgtgcact
gatgttgatgagtgtcagaatggagcgtgtgttctgaattctatctgcattaacactttg
ggatcttatcgctgtgggccttgcaaaccagggtacactggtgatcagacgaggggatgc
aagactgaaaggagctgccggaacccagagcagaacccatgcagtgtgcatgcgcagtgc
attgaggagcggcaaggggatgtgacgtgtgtgtgtggtgttggctgggctggtgacggc
tatgtctgtggaaaggatgtggacattgacagttaccctgatgaagaactgccatgctct
gccaggaactgcaagaaggataactgcaagtatgtgccaaactctggccaggaagatgca
gacagagatggcatcggagacgcgtgtgatgaggatgcagatggagatgggatcttgaat
gaacaggacaactgtgtcctgactcacaatatagaccaaaggaacagtgataaagatatc
tttggggatgcctgtgacaactgccggatggtcctgaataatgaccagaaggatactgac
ggggatgggagaggagacgcctgtgatgacgacatggatggagatggaataaaaaacatt
ttggacaactgtcccagagttcccaaccgtgaccagcaggatcgggatggtgatgatgtc
ggagatgcttgtgacagctgtcctgatgtcagtaaccctaaccagtcggatgtggataac
gatctggttggggactcctgtgacaccaaccaagacagtgacggggatggccaccaggac
agcacagacaactgccccacagtcattaacagctcccagctggacactgacaaagatggg
atcggcgatgaatgtgatgacgatgacgataacgatggcatcccagacctggtgcctcct
ggcccagacaactgcaggctcgtccccaacccagcccaggaagatagcaacaatgacggg
gtaggagatatctgtgaagctgacttcgaccaggaccaggtcatcgatcacattgatgtg
tgccctgagaatgcggagatcaccctgactgacttcagggcctaccagacagtggtcctg
gaccctgaaggggatgctcagatcgaccccaactgggtggtcctgaaccagggcatggaa
attgtgcagaccatgaacagtgaccctggcctagctgttgggtacacggcatttaacgga
gttgactttgaagggaccttccacgtaaacacccagacagatgatgactatgctggcttt
atttttggttaccaagacagctccagcttctatgtagtcatgtggaagcaaacggagcag
acatactggcaggctacaccgttccgtgcagtagcagaacctggtattcagctcaaggct
gtgaagtctaaaactggcccaggggaacatctccgaaactccctgtggcacacaggggac
accagcgaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaag
gtctcctaccgctggttcctgcagcataggccccaggtgggctacatcagggtgcgcttt
tatgaaggctcggagttggtggctgactctggggtcaccatagacaccaccatgcgtgga
ggccgacttggtgtgttctgcttctctcaagaaaacatcatctggtccaacctcaagtac
cgctgcaacgacaccataccagaggacttccaggagttccagacccagagtttcgaccgc
ttggataattga

DBGET integrated database retrieval system