KEGG   Mus musculus (house mouse): 12847
Entry
12847             CDS       T01002                                 
Symbol
Copa, AU040324, xenin
Name
(RefSeq) coatomer protein complex subunit alpha
  KO
K05236  coatomer subunit alpha
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12847 (Copa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12847 (Copa)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    12847 (Copa)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12847 (Copa)
  Exosomal proteins of bladder cancer cells
   12847 (Copa)
SSDB
Motif
Pfam: COPI_C Coatomer_WDAD WD40 ANAPC4_WD40 NBCH_WD40 TPR_14
Other DBs
NCBI-GeneID: 12847
NCBI-ProteinID: NP_034068
MGI: 1334462
Ensembl: ENSMUSG00000026553
UniProt: Q8CIE6 Q8BTF0
Structure
Position
1:171909885..171949899
AA seq 1224 aa
MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH
KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW
NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPGAVESD
VRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKAW
EVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAAH
PNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRSG
SKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAVW
VARNRFAVLDRMHSLLIKNLKNEITKKIQVPNCDEIFYAGTGNLLLRDADSITLFDVQQK
RTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESGV
FIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKFK
LALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIEI
ALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKMM
KIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLSAATHGLDEEAESLKETFDP
EKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGSIASKGKGGALAADIDIDTV
GTEGWGEDAELQLDEDGFVEAPEGLGEDVLGKGQEEGGGWDVEEDLELPPELDVPSGVSG
SAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLFL
QTYARGRTTYQALPCLPSMYSYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTVG
KFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLCMEIERKKLPKETLDQ
QKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQQ
TRKILSACEKNPTDACQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQI
CRVTTVTEIGKDVIGLRISPLQFR
NT seq 3675 nt   +upstreamnt  +downstreamnt
atgctaaccaaattcgagacgaagagcgcgcgggtcaaaggccttagttttcatcctaaa
agaccctggatcctgaccagtttacacaatggggtcatccagttatgggactatcggatg
tgcaccctaattgacaaatttgatgaacatgatggtccagtgcgtggcattgacttccat
aagcagcagccactgttcgtctctggaggcgatgattataagattaaggtttggaattac
aaacttcggcgctgcctgttcacattgctcgggcacttggattatatccgtacaacgttt
ttccatcatgaatatccttggattctgagcgcctcagatgatcagaccattcgggtgtgg
aactggcagtctagaacctgtgtctgtgtgttaacggggcacaaccattatgtaatgtgt
gctcagttccacccctctgaagacctggtggtatcagctagcctggaccagactgtccgc
gtttgggatatttctggtctaaggaagaaaaacttgtctcctggtgcggtggagtcggat
gtgagaggaataactggcgttgatctgtttggaaccacggatgccgtggtgaagcatgtg
ctagagggtcatgaccgtggagtcaactgggctgccttccacccgactatgccccttatt
gtatctggggcagatgaccggcaagtgaagatctggcgtatgaatgaatcaaaggcatgg
gaggttgacacctgccggggccattacaacaatgtgtcttgtgctgtttttcaccctcgc
caagagttgatcctcagcaattctgaagacaagagtattcgagtctgggatatgtctaag
cggactggggttcagactttccgtagggatcatgatcgcttctgggtcctggctgcccat
cccaaccttaacctctttgcagcaggccatgatggtgggatgattgtatttaagctggaa
cgtgagcgtcctgcctatgctgttcatggtaacatgctgcattatgtaaaggaccgattc
ctccgtcagctggatttcaacagctccaaagatgtagctgtgatgcagttgcggagcggt
tctaagtttccagtattcaacatgtcatacaatccagcagaaaacgcagtgctgctctgc
accagagcaagcaatctagagaacagtacctacgacctatacaccatccccaaagacgca
gactcccagaaccctgacgcccctgaagggaaacgatcctcaggcctgacagcggtttgg
gttgctcggaatcggtttgctgtcctagatcgcatgcattcacttctgattaaaaacctg
aaaaatgagatcaccaagaaaatccaggtgccaaactgtgatgaaatcttctatgctggt
acaggcaacctcctgcttcgggatgcagattccatcacactctttgacgtccagcagaag
cgaactctggcatcagtgaagatttccaaggtgaaatatgttatctggtcggcagacatg
tctcatgtagcgttactggccaagcatgccattgtgatctgtaaccgcaagctggatgct
ctgtgtaacattcatgagaacattcgtgtcaagagtggggcctgggatgaaagtggggtg
tttatctataccacaagcaaccacatcaaatatgctgtcaccactggggaccatgggatt
atccgaactctggatttacccatctatgtcaccagagtgaagggcaataatgtatactgc
ctagacagagagtgtcgtcctcgggtgctaaccattgatcccactgagttcaagttcaaa
ctggccctgatcaacagaaagtatgatgaggtactccacatggtgaggaacgctaagctg
gtaggccagtcaatcatcgcttatctccagaagaagggctatcctgaagtggcgctgcat
tttgtaaaggatgagaaaactcgtttcagcctggccctggagtgtggaaacattgagatt
gctctagaggcagccaaagccctggacgacaagaactgctgggagaagctaggagaagtg
gccctgctacagggcaatcaccaaattgtagagatgtgctatcagcgcaccaaaaacttt
gacaaactttccttcctgtaccttattactggcaacctggagaaacttcgaaagatgatg
aagatcgctgagatccgaaaggacatgagtggccattatcagaatgccctatacctaggt
gatgtgtcagagagagtacggatcctgaagaactgtgggcagaaatccctagcctatctc
tcagctgctacccatggcttagatgaagaagctgagagcctgaaggaaacctttgaccct
gagaaggagacaatcccagacattgatcctaatgccaagctgctccagccacctgcacct
atcatgccattggatacaaactggcccttactgaccgtgtccaaagggttctttgaaggc
tccattgcaagcaaggggaagggaggagcattggctgctgacattgacatcgacactgta
ggcactgaaggctggggagaggacgcagagctgcagctggatgaagatgggtttgtggag
gctccagaaggtttgggagaggatgttcttggaaagggacaagaagaaggaggtggctgg
gatgtagaagaagatttggagctcccacctgagctggatgtaccctctggggtgtctggt
agtgctgaagatgggttctttgtgcccccaaccaagggaacaagcccaacgcaaatctgg
tgcaataactcccagcttccagtagatcacatcttggcaggttcttttgaaacagccatg
cggcttctccatgatcaggtgggagtaatccagtttggcccctataagcaactgttccta
cagacatatgcccgaggccgcaccacctatcaagcgctgccctgcttgccctccatgtat
agttaccctaatcgcaattggaaggatgcagggctaaagaatggagtaccagctgtaggc
ctaaagcttaatgacctgatccaacgtttgcaactgtgttatcagctcaccacagttggc
aagtttgaggaagctgtggaaaaattccgttccatcctactcagtgtgcctcttcttgtt
gtggacaataaacaggagattgcagaggcccagcagctcatcaccatttgccgtgaatac
attgtgggtttgtgcatggagatagaaaggaagaagctacctaaggagaccctagaccag
cagaagcgcatctgtgagatggcagcctacttcacacactcaaatctgcagcctgtgcat
atgatcttggtgctgcggacagccctcaaccttttcttcaagctcaagaacttcaagaca
gctgccacctttgcccgacgcctgctggaacttgggcccaagcctgaagtagctcagcag
acaagaaaaatcttatctgcctgtgagaaaaaccccacagatgcctgccagctcaattat
gacatgcacaacccctttgacatttgtgctgcatcttaccggcccatctaccgtggaaaa
ccagtggagaagtgtccactcagtggggcctgctattcccctgagttcaaggggcaaatc
tgcagggtcactacagtgacagagattggcaaagatgtgattgggctgaggatcagtcct
cttcagtttcgctaa

DBGET integrated database retrieval system