KEGG   Mus musculus (mouse): 12848Help
Entry
12848             CDS       T01002                                 

Gene name
Cops2, AI315723, C85265, Csn2, Sgn2, TRIP-15, Trip15
Definition
(RefSeq) COP9 signalosome subunit 2
  KO
K12176  COP9 signalosome complex subunit 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12848 (Cops2)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    12848 (Cops2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI DUF2087 FliS
Motif
Other DBs
NCBI-GeneID: 12848
NCBI-ProteinID: NP_034069
MGI: 1330276
Ensembl: ENSMUSG00000027206
Vega: OTTMUSG00000015340
UniProt: P61202
Position
2 F1; 2 61.76 cM
AA seq 443 aa AA seqDB search
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL
EGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS
TSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQ
TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIREC
GGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK
PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLI
KLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR
YTALDKWTNQLNSLNQAVVSKLA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacatggaggatgatttcatgtgcgatgatgaggaggactacgacctggagtac
tctgaagacagtaactctgagcccaatgtggatttggaaaatcagtactataattccaaa
gcactgaaagaagatgacccaaaagcagcattaagcagcttccaaaaggttttggagctt
gaaggtgagaagggagaatggggattcaaagcgctaaaacagatgatcaagattaacttc
aagttgacaaactttccagaaatgatgaacagatataagcaactattgacctatattcgg
agtgcagtcaccaggaactattctgaaaagtccattaattctatccttgattatatctcc
acttctaaacagatggatttactgcaggaattttatgaaacaacactggaagctttgaaa
gatgctaagaatgatagactgtggtttaagacaaacacaaagcttggaaaattatattta
gaacgagaagaatatggaaagcttcaaaaaattttacgacagttacatcagtcttgtcag
actgatgatggagaagatgacctgaaaaaaggtacccagttattagaaatctatgctttg
gaaattcaaatgtacactgcacagaagaacaacaaaaagcttaaagcactctatgagcaa
tcacttcacatcaagtctgccatccctcacccactaatcatgggtgtcatcagagaatgc
ggtggtaagatgcacttgagagaaggtgaatttgaaaaggcacacactgatttttttgaa
gccttcaagaattatgatgaatcaggaagcccaagacgaaccacttgtttaaaatatttg
gttttagcaaatatgctaatgaaatcaggaataaatccgtttgactcacaagaggccaag
ccgtataaaaatgatccagaaattctagcaatgacaaatttagtaagtgcctatcagaat
aatgacatcactgaatttgaaaagattctgaaaacaaatcacagcaacatcatggatgat
cctttcataagagagcacattgaagaacttttacgaaacatcagaacacaagtcctcata
aagttaattaagccttacacaagaatacatattccttttatttctaaggagctaaacata
gacgtagctgatgtggagagcttgctggtgcagtgcatactggataacactattcatggc
cgaattgatcaagtcaaccagctccttgaactggatcatcagaagaggggtggtgcccga
tacactgcgctagataaatggaccaaccaactaaattctctgaaccaggctgtggtcagt
aaactggcttaa

DBGET integrated database retrieval system