KEGG   Mus musculus (mouse): 12854Help
Entry
12854             CDS       T01002                                 

Gene name
Cort, CST, PCST
Definition
(RefSeq) cortistatin
  KO
K05238  cortistatin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12854 (Cort)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Somatostatin
Motif
Other DBs
NCBI-GeneID: 12854
NCBI-ProteinID: NP_031771
MGI: 109538
Ensembl: ENSMUSG00000028971
Vega: OTTMUSG00000010957
UniProt: P56469
Position
4 E2; 4 78.89 cM
AA seq 109 aa AA seqDB search
MMGGRGTGGKWPSAFGLLLLWGVAASALPLESGPTGQDSVQEATEGRSGLLTFLAWWHEW
ASQASSSTPVGGGTPGLSKSQERPPPQQPPHLDKKPCKNFFWKTFSSCK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtggccgaggcacaggaggcaagtggccctcagccttcgggctgctgctgctc
tggggggtcgcagcctccgcccttcccctggagagtggccctactggccaggacagtgtg
caggaagccaccgaggggaggagcggccttctgactttccttgcctggtggcacgagtgg
gcttcccaagccagctccagcacccccgtcggagggggtacccccgggctgtccaagagc
caggaaaggccacccccccaacagcccccacacctggataaaaagccctgcaagaacttc
ttctggaaaaccttctcctcgtgcaagtaa

DBGET integrated database retrieval system