KEGG   Mus musculus (mouse): 12857Help
Entry
12857             CDS       T01002                                 

Gene name
Cox4i1, AL024441, COX, COX_IV-1, COXIV, Cox4, Cox4a, IV-1
Definition
(RefSeq) cytochrome c oxidase subunit 4I1
  KO
K02263  cytochrome c oxidase subunit 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12857 (Cox4i1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12857 (Cox4i1)
  09159 Environmental adaptation
   04714 Thermogenesis
    12857 (Cox4i1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    12857 (Cox4i1)
   05012 Parkinson disease
    12857 (Cox4i1)
   05016 Huntington disease
    12857 (Cox4i1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    12857 (Cox4i1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX4
Motif
Other DBs
NCBI-GeneID: 12857
NCBI-ProteinID: NP_001280488
MGI: 88473
Ensembl: ENSMUSG00000031818
Vega: OTTMUSG00000043013
UniProt: P19783 A2RSV8
Position
8 E1; 8 69.99 cM
AA seq 169 aa AA seqDB search
MLASRALSLIGKRAISTSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSASQK
ALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIW
EKSYVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgttggcttccagagcgctgagcctgattggcaagagagccatttctacttcggtgtgc
cttcgagcacatgggagtgttgtgaagagtgaagactatgctttccccacttacgctgat
cggcgtgactaccccttgcctgatgtggcccatgtcacgatgctgtctgccagccagaag
gcgctgaaggagaaggagaaggccgactggagcagcctttccagggatgagaaagttcag
ttgtaccgcatccagtttaacgagagcttcgccgagatgaacaggggcaccaatgaatgg
aagacagttgtgggcatggccatgttcttcattggcttcactgcgctcgttctgatttgg
gagaagagctatgtgtatggccccatccctcatactttcgatcgtgactgggtggccatg
cagaccaagcgaatgctggacatgaaggccaaccccattcagggcttctccgccaagtgg
gactatgacaagaatgagtggaagaagtga

DBGET integrated database retrieval system