KEGG   Mus musculus (house mouse): 12858
Entry
12858             CDS       T01002                                 
Symbol
Cox5a, CcOX
Name
(RefSeq) cytochrome c oxidase subunit 5A
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12858 (Cox5a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12858 (Cox5a)
  09159 Environmental adaptation
   04714 Thermogenesis
    12858 (Cox5a)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    12858 (Cox5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12858 (Cox5a)
   05012 Parkinson disease
    12858 (Cox5a)
   05014 Amyotrophic lateral sclerosis
    12858 (Cox5a)
   05016 Huntington disease
    12858 (Cox5a)
   05020 Prion disease
    12858 (Cox5a)
   05022 Pathways of neurodegeneration - multiple diseases
    12858 (Cox5a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12858 (Cox5a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12858 (Cox5a)
SSDB
Motif
Pfam: COX5A
Other DBs
NCBI-GeneID: 12858
NCBI-ProteinID: NP_031773
MGI: 88474
Ensembl: ENSMUSG00000000088
UniProt: P12787
Structure
Position
9:57423012..57439710
AA seq 146 aa
MLAAALRRCTAAAAARGLLHPASAPSPAAAVCSIRCYSHGSHETDEEFDARWVTYFNKPD
IDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYP
YVIQELRPTLNELGISTPEELGLDKV
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctcgccgctgccctccgtcgctgtaccgcagccgcggctgcccgaggcctcctgcac
cccgcctcggctcccagccccgccgccgctgtctgttccattcgctgctattctcatggg
tcacacgagacagatgaggagtttgatgctcgctgggtgacatatttcaacaagccagac
attgatgcctgggaattgcgtaaagggatgaatacacttgttggctatgatctggttcct
gagcccaaaatcattgatgctgcattgcgagcatgtagacggttaaatgattttgctagt
gctgttcgcatcttggaggttgttaaggacaaagcaggacctcataaggaaatctatccc
tatgtcatccaggaacttagaccaactttaaatgaattgggaatctccactccagaggag
ctgggccttgacaaagtgtaa

DBGET integrated database retrieval system