KEGG   Mus musculus (house mouse): 12868
Entry
12868             CDS       T01002                                 
Symbol
Cox8a, COX8L
Name
(RefSeq) cytochrome c oxidase subunit 8A
  KO
K02273  cytochrome c oxidase subunit 8
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04260  Cardiac muscle contraction
mmu04714  Thermogenesis
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    12868 (Cox8a)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12868 (Cox8a)
  09159 Environmental adaptation
   04714 Thermogenesis
    12868 (Cox8a)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    12868 (Cox8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12868 (Cox8a)
   05012 Parkinson disease
    12868 (Cox8a)
   05014 Amyotrophic lateral sclerosis
    12868 (Cox8a)
   05016 Huntington disease
    12868 (Cox8a)
   05020 Prion disease
    12868 (Cox8a)
   05022 Pathways of neurodegeneration - multiple diseases
    12868 (Cox8a)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    12868 (Cox8a)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12868 (Cox8a)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 12868
NCBI-ProteinID: NP_031776
MGI: 105959
Ensembl: ENSMUSG00000035885
UniProt: Q64445
Position
19:complement(7192523..7194981)
AA seq 69 aa
MSVLTPLLLRSLTGSARRLMVPRAQVHSKPAREQLGVLDITIGLTSCFVCCLLPAGWVLS
HLESYKKRE
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtctgtcctgacgccactgctgctgaggagcctgaccggctcggcccggcggctcatg
gtgccgcgggctcaggtccactcgaagccggcgcgggagcagctcggggtcctggatatc
accattgggctcacttcctgcttcgtgtgttgtcttctgcctgcgggctgggtcctgtca
cacctggagagctacaagaagcgggagtga

DBGET integrated database retrieval system