KEGG   Mus musculus (mouse): 12870Help
Entry
12870             CDS       T01002                                 

Gene name
Cp, D3Ertd555e
Definition
(RefSeq) ceruloplasmin
  KO
K13624  ceruloplasmin [EC:1.16.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00860  Porphyrin and chlorophyll metabolism
mmu04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    12870 (Cp)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    12870 (Cp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12870 (Cp)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     12870 (Cp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   12870 (Cp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu-oxidase_2 Cu-oxidase_3 Cu-oxidase
Motif
Other DBs
NCBI-GeneID: 12870
NCBI-ProteinID: NP_031778
MGI: 88476
Ensembl: ENSMUSG00000003617
Vega: OTTMUSG00000023513
UniProt: Q61147
Position
3; 3 A2
AA seq 1061 aa AA seqDB search
MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLISVDTEQSNFYLQNGP
DRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAEVEDKVYVHLKNLASRIYTFH
AHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANEPSPGEGDSNCVTRIYHS
HVDAPKDIASGLIGPLILCKKGSLYKEKEKNIDQEFVLMFSVVDENLSWYLEDNIKTFCS
EPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVKWYLFGMGNEVDVHSAFFHG
QALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNLNHLKAGLQAFFQVRDCNKPS
PEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTALESDSRVFFEQGATRIGGSYK
KMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGDTIKVTFHNKGQHPLSIQPMGVS
FTAENEGTYYGPPGRSSQQAASHVAPKETFTYEWTVPKEMGPTYADPVCLSKMYYSGVDP
TKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFPTVFDENESLLLDDNIRMFTTAPD
QVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGESIVWYLFSAGNEADVHGIYFSGNTY
LSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECLTTDHYTGGMKQKYTVNQCQRQFEDF
TVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQEQNVSNVFLDKEEFFIGSKYKKVVYR
QFTDSSFREQVKRRAEDEHLGILGPPIHANVGDKVKVVFKNMATRPYSIHAHGVKTESST
VVPTLPGEVRTYTWQIPERSGAGREDSACIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYV
KVFSPKKKMEFFLLFLVFDENESWYLDDNIKTYSEHPEKVNKDNEEFLESNKMHAINGKM
FGNLQGLTMHVKDEVNWYVMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDLFPGTYQT
LEMFPQTPGTWLLHCHVTDHVHAGMATTYTVLPVEQETKSG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttgctgcttagcacatttatatttttgtatagttccttagccttggcaaga
gataagcattatttcattggaattactgaagcagtctgggactatgcttctggcactgaa
gaaaagaaacttatttcagttgacacggaacagtccaatttctatcttcaaaatggtcca
gatcgtattggaagaaaatataagaaggccctttattttgagtacacagatggcaccttt
agtaagactatagacaaaccagcctggctagggtttttaggccctgtcatcaaagctgaa
gttgaagataaagtttatgttcacttaaagaaccttgcctctaggatctacacttttcat
gcacatggggtaacgtacaccaaggagtatgagggagccgtctaccctgacaacaccact
gattttcaacgggctgatgacaaagtgcttcccggacaacagtatgtgtatgtgctgcat
gccaatgagccaagtcctggagagggagacagcaattgtgtgaccaggatttaccactcc
catgttgatgctccaaaagatattgcatcaggactcataggacctctaatactctgtaaa
aaaggttctctatataaggaaaaagagaaaaatattgaccaagaatttgtactaatgttc
tctgtggtggatgaaaatctcagctggtatctggaagataacatcaaaaccttctgctct
gaacccgagaaagttgataaagacaatgaagacttccaggaaagcaacaggatgtactct
ataaatggatatacatttggaagcctcccagggctctcgatgtgtgcagcagacagagtg
aagtggtacctttttggtatgggtaatgaagttgatgtgcattcagctttctttcatggc
caagccctgaccagcaggaactatcaaaccgatataatcaacctgttccctgccacccta
attgatgcttatatggtggcccagaatcctggagtctggatgctcagttgccagaaccta
aaccatctgaaagctgggttgcaggcctttttccaggttcgtgactgtaacaagccctcg
ccagaggataatatccaagataggcatgtgagacactattacattgctgctgaggaggtc
atctggaattatgctccttctgggacggacatcttcactggagagaatttaacagctctg
gaaagtgattcaagggtattttttgagcaaggtgccacaagaattggtggctcttataaa
aaaatggcatatcgtgagtacacagatggttccttcacaaaccgaaaacaaagaggccct
gatgaggaacatcttggaatcctaggtcctgtcatttgggcagaagtaggagacaccatt
aaagtcacctttcataacaaaggacagcatcctctcagcattcagccaatgggagtaagt
ttcactgcagaaaatgagggaacatactatggcccaccaggtcgctcctcacagcaagca
gcctcccatgtggctcccaaagaaacctttacatacgaatggactgtccccaaagaaatg
ggacccacttatgcagatcctgtgtgcctatctaagatgtactactctggcgttgacccc
accaaagatatatttactgggcttattgggccaatgaaaatatgcaagaaaggcagctta
cttgctgatgggagacagaaagatgtagacaaagagttctacttgtttcccacagtgttt
gatgagaatgagagtttactcttagatgataatatcaggatgttcacaactgcacctgat
caagtggataaggaagatgaagactttcaggagtctaataagatgcactccatgaatggg
ttcatgtatggcaatcagcctggcctcaatatgtgtctaggagaatccatcgtgtggtat
ttgttcagcgctggaaatgaggctgatgtgcatgggatatacttttcaggaaatacttat
ctgtctaaaggagaaagaagagacactgcaaacctattccctcataaaagtctcaccctt
ctcatgaaccctgacacaaaagggacttttgatgttgagtgccttacaacggatcactac
acaggtggcatgaagcaaaaatacactgtgaaccagtgccagcggcagtttgaagatttc
actgtctaccttggagaaaggacctactatgtggcagccgtagaggtggaatgggattac
tcaccaagcagggcctgggaaaaggagctgcatcatttgcaagagcaaaatgtttcaaat
gtatttttggataaagaagagtttttcataggctcaaagtacaagaaggttgtgtatcgc
cagtttactgacagctcattcagagaacaggtgaagagacgagccgaagacgagcacttg
ggcatccttgggccaccaattcatgcaaatgttggagacaaagttaaagttgtctttaaa
aatatggcaaccaggccatattcaatacatgcccatggggtgaaaacagagagttctaca
gttgttccaacgttaccaggtgaagttcgaacttatacatggcaaattccagaaagatca
ggggctggaagagaggattcagcttgtatcccatgggcttattactcaactgtggatcga
gttaaggatctctatagtgggctaataggcccattgattgtttgtcggaagtcttatgtg
aaagtattcagtcctaaaaagaaaatggagtttttccttctgtttctagtatttgatgag
aatgaatcttggtacttagatgataacatcaaaacatactctgaacaccctgagaaagta
aacaaagacaacgaggaattcctagaaagcaataaaatgcatgctattaatgggaaaatg
tttggaaacctacaaggcctcacaatgcacgtgaaagatgaagtcaactggtatgtgatg
ggaatgggcaatgaaatagacctgcacactgtacacttccacggccacagcttccaatac
aagcacaggggagtatacagttctgatgtctttgaccttttccctggaacataccaaacc
ctagaaatgtttccccaaacacctggaacctggttactccactgccacgtgactgaccat
gtccatgctgggatggcaactacctacactgttttaccagtagaacaagagactaagtct
ggctga

DBGET integrated database retrieval system