KEGG   Mus musculus (mouse): 12873
Entry
12873             CDS       T01002                                 

Gene name
Cpa3, MC-CPA
Definition
(RefSeq) carboxypeptidase A3, mast cell
  KO
K08780  carboxypeptidase A3 [EC:3.4.17.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04972  Pancreatic secretion
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    12873 (Cpa3)
  09154 Digestive system
   04972 Pancreatic secretion
    12873 (Cpa3)
   04974 Protein digestion and absorption
    12873 (Cpa3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12873 (Cpa3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     12873 (Cpa3)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   12873 (Cpa3)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 DUF1642 GATase1_like FAM180
Other DBs
NCBI-GeneID: 12873
NCBI-ProteinID: NP_031779
MGI: 88479
Ensembl: ENSMUSG00000001865
Vega: OTTMUSG00000051236
UniProt: P15089 Q542E3
Position
3 A2; 3 6.25 cM
AA seq 417 aa
MRFFLLMAVIYTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAIHDI
AVNMTVDFRVSEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQFDVKDEIAGRHSYAKYN
DWDKIVSWTEKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREW
ISPAFCQWFVYQATKSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRN
QNSTCIGTDLNRNFDVSWDSSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNSIKAY
ITFHSYSQMLLIPYGYTFKLPPNHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSG
SSLDWVYDLGIKHTFAFELRDKGKSGFLLPESRIKPTCKETMLSVKFIAKYILKNTS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaggttcttcttgcttatggctgtcatctacactacacttgcaattgctcctgtccac
tttgacagggagaaggtattccgtgtgaaactccagaatgaaaagcacgccagtgtcttg
aagaacttgacccaaagcattgagctcgacttctggtatccagatgctatccatgatatt
gctgtgaatatgactgtggatttccgagttagtgagaaggaatctcagaccatccagtca
accttggaacaacataaaatccattatgaaattctgatacatgacctacaagaagagata
gagaaacagtttgatgtgaaagatgaaatcgcaggcaggcacagttatgcaaaatacaat
gactgggacaagattgtttcttggactgaaaaaatgttagaaaaacatcctgagatggtt
tcaaggattaaaattggatcaactgttgaagataatccattatatgtcctcaagattggg
aaaaaagatggagaaagaaaggctatctttatggactgtggcattcatgcacgtgaatgg
atttctccagctttctgtcagtggtttgtctatcaggcaaccaagagttatggaaaaaat
aaaatcatgaccaaactcttggaccggatgaatttttacgttctgcctgtattcaatgta
gacggatacatttggtcatggacacaggatcgaatgtggagaaaaaaccgttccaggaac
caaaactccacctgcattggcactgacctcaacaggaactttgatgtctcgtgggactct
tctccaaacaccaacaaaccatgcctcaatgtctacaggggacctgcaccagagtctgag
aaagagacaaaagctgtcaccaacttcattcgaagccatctgaactcaatcaaggcttat
atcactttccattcctactcgcagatgctattaattccttatggctacacattcaaactg
cctcctaaccaccaggacctattgaaagttgcaaggattgccacggatgctctctcaact
agatatgaaacccgttacatctacggcccaatagcatccacaatttacaagacttcaggc
tcttccttagactgggtttatgacctgggcatcaaacacacatttgcctttgagcttcgt
gataaaggaaagtctgggtttcttcttccagaatcccggataaagccaacatgtaaagaa
accatgctttctgtcaaatttattgccaagtatatcctcaagaatacttcctaa

DBGET integrated database retrieval system