KEGG   Mus musculus (mouse): 12874
Entry
12874             CDS       T01002                                 

Gene name
Cpd, AA960140, AW322530, D830034L15Rik
Definition
(RefSeq) carboxypeptidase D
  KO
K07752  carboxypeptidase D [EC:3.4.17.22]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12874 (Cpd)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.22  metallocarboxypeptidase D
     12874 (Cpd)
Peptidases and inhibitors [BR:mmu01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   12874 (Cpd)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA PEGA
Other DBs
NCBI-GeneID: 12874
NCBI-ProteinID: NP_031780
MGI: 107265
Ensembl: ENSMUSG00000020841
Vega: OTTMUSG00000006239
UniProt: O89001
Position
11 B5; 11 46.05 cM
AA seq 1377 aa
MASGRDERPPWRLGRLRLLPPPPLLLLLLLLRSSAQAAHIKKAEATTTTVGGSEAAEGQF
DHYYHEAALGEALEAAAAAGPPGLARLFSIGSSVEGRPLWVLRLTAGLGPPPTAAAGLDA
AGPLLPGRPQVKLVGNMHGDETVSRQVLVYLARELASGYRRGDPRLVRLLNTTDVYLLPS
LNPDGFERAREGDCGLGDSGPPGTSGRDNSRGRDLNRSFPDQFSTGEPPSLDEVPEVRAL
IDWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKTTGLYSKTSDDEVFRYLAKAYASNHPI
MKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQ
LRQEWENNRESLITLIEKVHIGIKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHR
LLVPGTYNLTALSTGYMPLTINNIMVKEGPATEMDFSLRPTVMSVMPGSTEAVTTPGTVA
VPNIPPGTPSSHQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVM
EISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVRSTRIH
LMPSMNPDGYEKSQEGDSISVVGRNNSNNFDLNRNFPDQFVPITEPTQPETIAVMSWVKA
YPFVLSANLHGGSLVVNYPYDDNEQGVATYSKSPDDAVFQQIALSYSKENSQMFQGRPCK
DMYLNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFENELPKYWEQN
RRSLIQFMKQVHQGVKGFVLDATDGRGILNATLSVAEINHPVTTYKAGDYWRLLVPGTYK
ITASARGYNPVTKNVTVRSEGAVQVNFTLVRSSADANNESKKGRGHSTSTDDTSDPTSKE
FEALIKHLSAENGLEGFMLSSSSDLALYRYHSYKDLSEFLRGLVMNYPHITNLTTLGQSV
EYRHIWSLEISNKPNISEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKRNPVVTQ
LVDRTRIVIVPSLNPDGRERAQEKDCTSKTGHTNAHGKDLDTDFTSNASQPETKAIIENL
IQKQDFSLSIALDGGSVLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNN
SDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPALWAENKKS
LLSMLVEVHKGVHGLVKDKAGKPISKAVIVLNEGIKVYTKEGGYFHVLLAPGVHNINAIA
DGYQQQHTQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCIC
SIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
NT seq 4134 nt   +upstreamnt  +downstreamnt
atggcgagcggccgggatgagcggccgccctggcggctgggacgcctgcgtctgctgccg
ccgccaccgctgctgctgctgctgctgctactgaggagctcggcccaggcggcgcacatc
aagaaggctgaggcgaccacgacaaccgttggcggctccgaggcggccgagggccagttt
gaccactactaccacgaagcggcgctgggcgaggcgctggaagcggcggcggccgcgggg
ccacccggcctggcgcgtctcttcagcatcggcagctcggtggagggccggccgctgtgg
gtgctgcgcctcacagcgggcctggggccgccgcccaccgccgccgcggggctggacgcc
gcggggccgctgctgcccggccggccgcaggtgaagctggtgggtaacatgcacggcgac
gagacggtgtcacgccaggtgttggtctacctggcccgcgagctggcgtcgggctaccgc
cgcggggacccgcgcctggtccgcctgctcaacaccaccgacgtgtatttgctgcccagc
ctgaacccggatggcttcgaacgtgcccgcgagggtgactgcggcctcggcgacagcggc
ccgcctgggaccagcggccgtgacaacagccgaggccgcgacctcaaccgcagcttccct
gaccagttcagcaccggcgagccaccttccctggatgaggtgccggaggtgcgcgccctc
atcgactggatccgcaggaacaagtttgtgctttctggaaatcttcatggtggctcagtg
gtagcaagctatccttttgatgattctcccgagcataagaccactggactctatagcaaa
acctccgatgatgaagtctttagatacttggcaaaagcttatgcctctaaccaccctata
atgaaaactggcgaaccccattgtccaggagatgaagacgagactttcaaagatgggatc
acgaatggcgcgcactggtatgacgtggaaggtggtatgcaagattacaattatgtatgg
gccaactgttttgagatcacattagaattgtcttgctgcaagtacccacctgcttctcag
cttcgacaagaatgggagaataatcgtgagtctttgatcacattgattgaaaaggtccac
attggaattaaaggatttgttaaagattccgtaacaggctctgggttagagaacgcaacc
atttcagtggctggtattaatcataacatcacaacgggaagatttggtgatttccacaga
ttacttgttcctggaacttacaatcttacggcgctttcaactgggtatatgccattgacc
attaataatataatggtgaaagaagggccagctacagagatggatttctcccttcggcca
actgtgatgtcagtaatgcctggttcaactgaggctgtaacaactcctggcacagttgct
gttcctaatatccctcctggaacaccatcctcccatcagccaattcagcctaaagacttt
caccaccaccattttcccgacatggaaatcttcttgagaagatttgccaatgaatatcct
aatatcacccgtctttattctctggggaaatccgtagagtcaagagaactgtatgtgatg
gagatatctgataacccaggtgtccatgaaccaggtgaaccagaatttaagtatattgga
aatatgcatggaaatgaagtggttggaagagagctgctattgaatctcattgaatacctc
tgcaagaattttggaacagaccctgaagtaacagatttggttcgcagcacaagaattcac
cttatgccatccatgaatcctgatggatatgaaaagtcccaggaaggagattcgatcagt
gtagttggcagaaacaacagcaacaactttgacctaaaccggaatttcccagaccagttt
gttccaatcacagaacctacccaaccagaaactatcgctgtgatgagctgggtgaaggcc
tacccgtttgtgctgtcagccaatctgcacgggggttccctggtggttaactacccttat
gatgataatgagcaaggagttgccacgtacagcaagtcaccagatgatgctgtatttcag
caaatagcactttcttattccaaggaaaattcgcagatgttccaaggtagaccttgcaag
gacatgtatctcaatgagtattttcctcatgggataacaaacggagctagttggtataac
gtcccaggtggtatgcaggactggaactatttacagacaaattgctttgaagtaactatc
gaactcggttgtgtgaaatatccatttgagaatgaactgccaaagtactgggagcaaaat
cgaagatctctaatccagtttatgaaacaggttcatcagggtgtcaaaggatttgtcctt
gatgccacagatggtaggggcatattaaatgccaccctcagtgttgctgaaattaatcac
ccagtgaccacttacaaagctggagattactggcgcctcttggtcccagggacatacaaa
atcacagcatctgcccgagggtataaccctgtcaccaagaacgtgaccgtcaggagtgaa
ggtgctgttcaggtcaacttcacccttgttcgatcttcagcagatgcaaacaatgagtca
aagaaaggcagggggcatagcaccagcactgacgacaccagcgacccaacttctaaggag
tttgaagcattaatcaaacacctttcggctgagaatggcttggaaggcttcatgttaagc
tcgtcctcagacctggctctgtatcgataccattcatacaaagacttatccgagttcctg
agaggacttgtaatgaactacccgcacattacaaaccttaccactttgggacagagtgtt
gagtatcgtcacatttggtccctggagatctccaataagcccaacatatcagaacctgaa
gaaccgaagattcgttttgttgctggtatccatggaaacgctccagttggaactgaactg
ctcttggctctggcagaatttctttgcctgaattacaaaaggaacccagttgttacccaa
ttggttgacaggactagaattgtgattgttccctctctgaatccagatgggcgagagcgt
gctcaagagaaagactgcacctcaaagactgggcacacaaatgctcatggcaaagacctg
gacacagactttacaagtaatgcttctcagcctgagaccaaagccatcatcgaaaacttg
attcaaaagcaggacttcagtctttccattgccttagatggtggttctgtgctggtcaca
tatccgtatgataaaccagtgcagacagtggaaaacaaagaaactttaaagcatttggca
tctctttatgcaaataaccatccatcaatgcacatgggtcagcccagttgcccaaataat
tcagatgagaacatacctggaggagtgatgcggggagccgagtggcacagtcacctgggc
agcatgaaggattatagtgtcacctatggccattgcccagaaatcacggtatacacaagc
tgctgctacttcccaagtgcagctcagctccctgccctatgggcagagaacaagaagtct
ctccttagcatgctggtggaggtccacaaaggagtccacgggttagtaaaagacaaggct
ggtaaaccaatctcgaaagcagtcattgtactcaatgaaggaataaaagtatacacaaag
gaggggggttatttccatgtgctcctagctcctggagtccataacatcaacgcaattgct
gatgggtaccagcagcagcacacacaggtctttgtgcatcatgatgcagccagttctgtg
gtaatagtctttgatacagataaccggatatttggtttgccaagggaactcgtggtaact
gtgtcaggtgccactatgtcagcactgatcctaacggcttgcatcatttggtgcatctgc
tccatcaagtctaatagacacaaagatggcttccaccggctgcggcagcatcatgatgaa
tatgaagatgaaattcgcatgatgtcaactggctctaagaagtccctcctaagccatgag
ttccaggatgaaacggacacagaggaggaaacattatattctagcaaacattga

DBGET integrated database retrieval system