KEGG   Mus musculus (mouse): 12877
Entry
12877             CDS       T01002                                 

Gene name
Cpeb1, AU024112, Cpe-bp1, Cpeb, mCPEB, mCpeb-1
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 1
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    12877 (Cpeb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12877 (Cpeb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12877 (Cpeb1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     12877 (Cpeb1)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     12877 (Cpeb1)
   mRNA cycle factors
    P-body specific factors
     12877 (Cpeb1)
SSDB
Motif
Pfam: CEBP1_N RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 12877
NCBI-ProteinID: NP_031781
MGI: 108442
Ensembl: ENSMUSG00000025586
Vega: OTTMUSG00000024594
UniProt: P70166
Position
7; 7 D3
AA seq 561 aa
MAFSLEEAAGRIKDCWDNQEVPALSTCSNANIFRRINAILDDSLDFSKVCTTPINRGIHD
QLPDFQDSEETVTSRMLFPTSAQESPRGLPDANGLCLGLQSLSLTGWDRPWSTQDSDSSA
QSSTQSVLSMLQNPLGNVLGKAPLSFLSLDPLGSDLDKFPAPSVRGSRLDTRPILDSRSS
SPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLSMTGNGPRDPLKMGVGSRMDQEQAALA
AVAPSPTSAPKRWPGASVWPSWDLLGAPKDPFSIEREARLHRQAAAVNEATCTWSGQLPP
RNYKNPIYSCKVFLGGVPWDITEAGLVNTFRVFGSLSVEWPGKDGKHPRCPPKGNMPKGY
VYLVFELEKSVRALLQACSHDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVWS
PSQRLDPSRTVFVGALHGMLNAEALAAILNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQ
RSYLKAVTAAFVEIKTTKFTKKVQIDPYLEDSLCLICSSQPGPFFCRDQVCFKYFCRSCW
HWRHSMEGLRHHSPLMRNQKN
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggctttctctctggaagaagcagcaggaagaataaaggattgctgggacaaccaagaa
gttcctgcactctctacatgtagcaatgccaatatctttcgaaggataaatgccattttg
gatgattcactggacttcagtaaagtctgtacaacacctataaatcgaggaattcatgat
cagttgccagacttccaggactctgaagaaacagttacaagcaggatgcttttccccacc
tctgcgcaagaatctccccgtggcctcccagatgcaaatggcttgtgccttggcctgcag
tccctcagtctgactggctgggaccgaccctggagcacccaggactcagactcctcagcc
cagagcagcacacagtcagtattaagcatgctccaaaatccactgggaaatgtcttagga
aaagcccccttgagcttcctgtctctggatccccttgggtctgacttggacaagttccca
gcaccctcagttagaggatctcgcctggacacccggcccatcctggactcccgttctagc
agcccctctgactcagacacgagtggcttcagctctggatcagaccatctctcagatttg
atttcaagccttcgcatttcccctcctctgccctttctttctatgacgggaaatggtccc
agagaccctctaaagatgggcgttgggtcccgaatggaccaagaacaagctgctcttgct
gcagttgctccctctccaaccagtgctccaaagagatggccaggagcttctgtgtggcca
tcttgggaccttcttggagctcctaaagacccattcagcatagagagagaggctagactc
caccggcaggctgcagctgtgaatgaagctacgtgtacctggagtggccagcttcctccc
cggaactataagaaccccatctactcatgcaaggtgttcctaggaggcgttccttgggat
attacagaagctggattggttaacaccttccgtgtttttggctctctgagtgtggagtgg
cctggtaaggatggcaagcacccccggtgtcctcccaaaggtaatatgcctaaagggtat
gtgtatttggtgtttgaactagagaagtccgtccgggccttgcttcaggcttgttctcat
gacccgctgagcccagatggcctgagtgaatattatttcaagatgtccagccgaaggatg
cgctgcaaagaggtacaggtaatcccttgggtcttggctgacagcaactttgtctggagc
ccatctcagaggctggatcccagcaggacggtgtttgttggtgccttgcacgggatgctc
aatgctgaggctctggctgccatcttgaatgacctatttggtggagtggtgtatgctggg
attgacacagataagcacaagtaccccattgggtctggtcgtgtgactttcaataaccaa
cgtagttatctgaaagcagtcaccgctgcttttgtggagatcaaaaccaccaagtttacc
aagaaggttcagattgacccctatctagaagattctctgtgtcttatctgcagctcacaa
cctggtcctttcttctgccgagatcaggtctgcttcaagtacttttgcagaagctgctgg
cactggcgacacagcatggaaggcctacgccaccatagccccctaatgaggaaccagaag
aactga

KEGG   Mus musculus (mouse): 208922
Entry
208922            CDS       T01002                                 

Gene name
Cpeb3, 4831444O18Rik, CPE-BP3, mKIAA0940
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 3
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    208922 (Cpeb3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    208922 (Cpeb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    208922 (Cpeb3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     208922 (Cpeb3)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     208922 (Cpeb3)
   mRNA cycle factors
    P-body specific factors
     208922 (Cpeb3)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1 zf-B_box
Other DBs
NCBI-GeneID: 208922
NCBI-ProteinID: NP_001277755
MGI: 2443075
Ensembl: ENSMUSG00000039652
Vega: OTTMUSG00000033003
UniProt: Q7TN99 A0A0R4J102
Position
19; 19 C2
AA seq 716 aa
MQDDLLMDKSKTQPQSQQQQRQQQQQQQQLQPEPGAAEAPSTPLSSEIPKPEDSSAVPAL
SPASAPPAPNGPDKMQMESPLLPGLSFHQPPQQPPPPQEPTAPGASLSPSFGSTWSTGTT
NAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGTFSPQIGLAQTQHHQQPPPPAPQPPQP
AQPPQAQPSQQRRSPASPSQAPYAQRSAAAYGHQPIMTSKPSSSSAVAAAAAAAAASSAS
SSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSN
VIAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRT
DHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNTRSYGRRRGRSS
LFPFEDAFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPPDIDEDEITASFR
RFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKD
KPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGID
TDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGT
RCGGKFAPFFCANVTCLQYYCEYCWASIHSRAGREFHKPLVKEGGDRPRHVPFRWS
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcaggatgatttactgatggacaaaagcaaaacccagccccagtctcagcagcagcag
cggcagcagcagcagcagcagcaacagctccagcccgagcccggcgcagctgaagccccg
tccacgcccctctcctcagagatccccaagcccgaagacagtagcgcagtgccggccctc
agccccgcctcggctccgccagcccccaacggccccgacaagatgcagatggagtcgccg
ctcctgccgggcttgagtttccatcagccccctcagcagccgccgccgccgcaggagccc
acggcgcccggagcgtcgctgtcgccgtccttcggcagcacctggtccacaggcactaca
aacgcggtggaggacagcttcttccaggggatcaccccagtcaacgggaccatgctcttc
caaaacttcccgcaccacgtcaacccggtcttcggaggcaccttctcgccgcagatcggc
ctggcgcagacccagcaccatcagcagcctccaccgcccgcgccgcagccgccgcagccc
gcgcagcccccgcaggcgcagccctcgcagcaacgccgctcgcccgccagccccagccag
gcgccctatgcgcagaggagcgccgctgcctacggccaccagcccatcatgaccagcaag
ccgtcctcatcctcggcggtcgcggctgctgcggccgcggccgctgcctcttcggcctcg
tccagctggaacacgcaccagagcgtgaacgccgcctggagtgctccgtccaacccgtgg
ggtggcctgcaggcgggccgagaccctcgccgcgcggtcggcgtgggcgtgggtgtaggt
gtgggggtaccctccccgcttaaccccatctcgccgctcaaaaagcccttctccagcaat
gtgatcgctccacccaagttccctcgtgcagccccgctcacctccaagtcctggatggag
gataacgctttccggaccgataatggtaacaatctgttgccttttcaggaccggagtagg
ccctatgacacttttaacttgcactccttggagaactccttaatggatatgataaggact
gaccatgagcctctgaaaggtaaacactaccctcccagtggcccaccaatgagtttcgct
gatataatgtggaggaatcattttgcaggacgcatgggaataaatttccaccatccagga
acagataacattatggcacttaacaccaggagctatgggcggagacgaggtcggtcttct
ctctttccctttgaagacgccttcttggatgacagccatggtgatcaggccttatcgtct
ggcttaagttctcctactcgatgtcaaaatggggaacgagtggaacgctactctagaaag
gtgtttgttggaggccttcctcctgacatcgatgaagatgagatcactgccagctttcgc
aggtttggaccccttgtggtggactggcctcataaagccgagagcaaatcgtacttccct
cctaaaggctatgctttcctgctgttccaggaggagagctcagtgcaagctctgatagat
gcctgcctggaggaggatgggaaactgtacctgtgtgtgtccagcccaaccatcaaggat
aaaccggtgcaaatccgaccgtggaacctaagtgacagtgactttgtaatggatggctct
cagcctttggaccccagaaaaactatctttgttgggggagttccacgaccccttcgagct
gttgaactggcaatgataatggaccgtttgtacggtggtgtttgctatgctggcattgac
acagacccagagctgaagtacccgaaaggtgctgggcgtgttgcgttctccaatcagcag
agctacattgcagccatcagtgcgcgctttgtgcaacttcaacacaacgacattgacaaa
cgggtggaagtgaagccgtacgtgctggatgatcagatgtgtgacgagtgtcagggcaca
cgctgcggggggaagtttgccccattcttctgtgccaacgtcacctgtctgcagtactac
tgtgaatactgctgggccagcatccactcccgagccggccgtgagttccacaaaccgctg
gtgaaggagggaggcgaccgcccccggcacgtcccgttccgctggagctga

KEGG   Mus musculus (mouse): 231207
Entry
231207            CDS       T01002                                 

Gene name
Cpeb2, A630055H10Rik, Cpe-bp2
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 2
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    231207 (Cpeb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    231207 (Cpeb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    231207 (Cpeb2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     231207 (Cpeb2)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     231207 (Cpeb2)
   mRNA cycle factors
    P-body specific factors
     231207 (Cpeb2)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1
Other DBs
NCBI-GeneID: 231207
NCBI-ProteinID: NP_001170850
MGI: 2442640
Ensembl: ENSMUSG00000039782
Vega: OTTMUSG00000023193
UniProt: E9Q5X2
Position
5; 5 B3
AA seq 992 aa
MRDFGFGVLHTALLRSGSPRSSPGGSAYRPFAAGPPATPFGPLSPPPLPVTGFSEAASPF
AIPSGGGAASSAAASSSSPLVAHPQAVQDELLLGLTQQPTRPLSGAAAAEQLPSHHPGGG
TNAGVTHLLPSQDFKPSLHHPSSSSASSCCCCRTSSPQDFSKRQQQQLSSQKRKELSPPH
RPHPPDAKPPPPPPPLHCPGRFSPTPPTPPPPPGPLLQSAPLAQRSQPFSLPHTQHLPPQ
DFAQRQRPVDLPQLPQLPPSPPAAPRRRHGGAGSPRQTPAAGEGSAAEPPNAGLPPSTPP
VNPAPGSMESPNHPLLNSPSTLLPGAALGTSAFSSLQSPDLPHPGGGGGGGPPGGGGGSA
SPPPLPGFGTPWSVQTASPPPPQPPPATQQQPPQQPQPPQQPPQPQPPGSSAATPGSGGG
AGGSLSAMPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCAGLSVPAGGGGGGGGFG
GPFSAPTVPAPPAMNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNH
HQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPLKKPFSGNVI
APPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQDRSRMYDSLNMHSLENSLIDIMRA
EHDPLKGRLSYPHPGTDNLLMLNARSYGRRRGRSSLFPIDDSLLDDGHSDQVGVLNSPTC
YSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGY
AFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLD
PRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIA
AISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFC
WANIHSRAGREFHKPLVKEGADRPRQIHFRWN
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgcgggacttcgggttcggggtgctgcacactgccctgctgcgcagcggcagcccacga
tcctcgcccggcggcagcgcctaccggcccttcgccgccgggccgcccgccacgcccttc
ggcccgctgtcgccgccgccgttgcctgtcaccggcttctccgaggccgcctcccccttc
gccatcccctcgggcggcggcgcggccagctcagccgcagcttcctcttcctccccgctc
gtggcgcatccccaggccgtgcaggatgagctactgctcgggctgacacagcagccgacg
aggccgctctcgggggcggcggccgcagagcagctccccagccaccaccccggcggcggc
acgaacgcgggtgtgacccacctcctcccctcccaggacttcaaaccgagtctgcaccac
ccctcctcctcctccgcctcctcctgctgctgctgccgcacctcctccccgcaggacttc
agtaagcggcagcagcagcagctgagcagccagaagaggaaagagttgagcccgccacac
cgtccccaccctccggacgcgaagccgccgccgccgccgccgccgctccactgccccggc
cgcttcagcccaacaccgccaacgccgccaccaccgcccgggccgctcctgcagtcggcg
ccgctcgcccagcgctctcagccgttcagcctcccgcacacgcagcacctcccgccgcag
gacttcgcccagcggcagcgcccggtcgacctgccccagctcccgcagctcccgccctcg
ccgcccgcagctccgcggcgccgccacggaggcgcgggaagccctcgccagaccccggcc
gcgggcgagggcagcgccgccgagccccccaatgcgggcttgcccccctcgacgccgccg
gtgaaccccgcgccgggctccatggagtcgcccaaccaccctctgctcaacagccccagc
accctcctgcccggcgcggcgctcggcaccagcgccttcagcagcctgcagagcccggac
ctgccgcaccccggcggcggcgggggcgggggaccccccggagggggaggcggctccgcg
tctcccccaccgctgcccggcttcggcaccccctggtcggtgcagaccgcgtcgccgccg
ccgccccagcctccgccggcgacccagcagcagccaccccagcagccgcagccgccccag
cagccgccgcaaccacagcccccgggctcctcggctgccaccccgggcagcggcggcggc
gcgggcggctctctgagcgccatgccgccgcccagcccggactcggagaacggcttctac
cccgggctgccatcgtccatgaacccggccttcttcccgagcttctcgccggtgtcgccg
cacggctgcgcggggctcagcgtgccggccggcggtggcggcggcggcggcggcttcggc
ggcccgttctctgctcccacggtgcccgcgccgcccgccatgaatttacctcaacagcag
ccgccggcggcggcgccgcagcagccgcagagccggaggtcacccgtcagcccgcagctg
cagcagcagcaccaggctgccgcagccgccttcctgcagcagaggaactcgtacaaccac
caccagcctcttctgaaacagtctccttggagcaaccatcagaacagcggttggggcact
gcgagcatgtcctggggagcaatgcacggcagagatcaccgcaggagcggcaacatgggg
atcccagggactatgaatcagatatctccgctgaagaagccgttctcgggtaatgttata
gcaccaccgaaattcactcgctctactccatcactgactccaaaatcttggattgaagat
aatgtgttcaggacagacaacaatagtaacacactcttacccttacaggatcgaagtaga
atgtatgatagcttgaatatgcactctctggaaaattcccttattgatatcatgagagca
gagcacgatcctctcaagggtcgtctgagctatccacatccaggaaccgacaatctgtta
atgttaaatgcaaggagttatgggcgaagacgaggtcgctcttccctatttccaatagat
gatagcttgttggatgatggtcacagtgatcaagttggtgttttaaattcaccaacatgt
tattcagctcatcaaaatggagaacgaattgaacgcttctctcgaaaagtttttgttggt
gggcttcctccggatattgatgaagatgagatcactgccagcttccgaagatttggacct
ttggtagtagattggccccacaaagcagaaagtaaatcctattttccaccaaaaggctat
gcattcctcctctttcaagaagagagctcagtccaggcactcattgacgcttgcattgaa
gaagatggaaagctctacttgtgtgtttccagccctactatcaaagacaaacctgttcaa
atccgtccttggaatttaagtgatagtgatttcgtcatggatggttctcagcctttggat
ccccgaaaaacaatttttgttggaggtgttcctaggccactaagggctgtggaacttgct
atgatcatggaccggctgtatggtggtgtgtgttacgcaggaattgatacagatccagaa
ctcaaatacccaaaaggtgctgggcgagtcgctttctccaatcagcagagctacattgct
gccatcagtgctcgatttgttcagcttcagcacggtgacattgataaacgtgtggaggtg
aagccatatgtgctagatgaccagatgtgtgacgagtgccagggtgcacgctgtggtggg
aaatttgccccctttttctgtgccaatgtcacctgcctgcagtattactgtgagttttgt
tgggcaaatatccactctcgtgcaggacgcgagttccataagccattggtgaaggaaggt
gctgatcgcccacgtcagatccacttccgctggaactaa

KEGG   Mus musculus (mouse): 67579
Entry
67579             CDS       T01002                                 

Gene name
Cpeb4, Cpe-bp4, Cpeb-4, mCPEB-4
Definition
(RefSeq) cytoplasmic polyadenylation element binding protein 4
  KO
K02602  cytoplasmic polyadenylation element-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    67579 (Cpeb4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    67579 (Cpeb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    67579 (Cpeb4)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     67579 (Cpeb4)
   Factors involved in mRNA localization
    Trans-acting binding proteins
     67579 (Cpeb4)
   mRNA cycle factors
    P-body specific factors
     67579 (Cpeb4)
SSDB
Motif
Pfam: RRM_7 CEBP_ZZ RRM_1 zf-U1
Other DBs
NCBI-GeneID: 67579
NCBI-ProteinID: NP_080528
MGI: 1914829
Ensembl: ENSMUSG00000020300
Vega: OTTMUSG00000005363
UniProt: Q7TN98 Q3TSF0
Position
11; 11 A4
AA seq 729 aa
MGDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPNPAAFINNNTAANGSSAGSAW
LFPAPATHNIQDEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKAEENPG
DSSSENSNGKEKLRIESPVLTGFDYQEATGLGTSTQPLTSSASSLTGFSNWSAAIAPSSS
TIINEDASFFHQGGVPGASANNGALLFQNFPHHVSPGFGGSFSPQIGPLSQHHPHHPHFQ
HHHSQHQQQRRSPASPHPPPFTHRSAAFNQLPHLANNLNKPPSPWSSYQSPSPTPSSSWS
PGGGGYGGWGASQGRDHRRGLNGGITPLNSISPLKKNFASNHIQLQKYARPSSAFAPKSW
MEDSLNRADNIFPFPERPRTFDMHSLESSLIDIMRAENDSIKGRLNYSYPGSDSSLLINA
RTYGRRRGQSSLFPMEDGFLDDGRGDQPLHSGLGSPHCFTHQNGERVERYSRKVFVGGLP
PDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDG
KLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIM
DRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPY
VLDDQLCDECQGARCGGKFAPFFCANVTCLQYYCEYCWAAIHSRAGREFHKPLVKEGGDR
PRHISFRWN
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgggggattacgggtttggagtgctagtgcaaagcaatactgggaataaatctgctttt
ccagtccgattccatccacatctgcagcctccacaccatcaccaaaatgccacccccaac
cctgctgcttttataaataataacacagctgccaatggcagcagtgctgggtcagcctgg
ctctttcctgccccggctactcataacattcaggatgagatcttggggtcagaaaaagca
aaaagtcaacagcaagaacaacaagaccctttagaaaagcaacagctctccccgagtcca
ggtcaggaagctggaatactgcctgaaactgaaaaggcaaaagctgaagaaaatccaggg
gacagttcttcagaaaacagcaacggaaaagaaaaactacgcattgaatcaccagtgttg
acagggtttgattaccaagaagccaccggtctcgggacttccacccaacccttgacatcc
agtgcatcgtcccttactggtttcagtaactggtcagcagcgatagcaccttcttcctcc
actataatcaatgaagatgcaagtttctttcaccagggaggggtccctggcgcttcagct
aataatggtgctctcttgtttcaaaattttccccatcatgtcagccctggctttggtggt
agcttctcccctcagatcgggcctctctcccagcaccatcctcatcacccccatttccag
caccatcacagccagcatcagcagcagaggaggtctcctgccagtccccaccccccacct
ttcacacatagaagtgctgcttttaaccagctgcctcatttggcgaataatcttaacaaa
cctccttctccatggagcagctaccagagtccttctccaaccccctcttcttcctggagc
ccaggaggtggcggctacggtggctggggagcatctcaaggccgggatcaccgcagaggg
ctgaacggtggaataacacccctgaactcaatctcacctttgaagaaaaatttcgcaagc
aatcatattcagctccagaagtatgctcgccctagctcagcctttgctccaaaatcctgg
atggaagatagcttgaacagggctgacaacatttttccttttccggaacgccccaggacg
tttgacatgcactcactggagagctcactcattgacataatgagagctgaaaatgattcc
attaaaggtcgtctaaactattcatacccaggatccgatagttctctgcttattaatgca
aggacttatgggcgaaggagaggtcagtcttcattgtttccgatggaagatggattcctg
gatgatggccgtggggatcaacctcttcatagtggtctggggtcacctcactgcttcact
caccagaatggggagagagtggaacgatactctcgcaaagtgtttgtgggtggattgcct
cctgatattgatgaagatgagatcacagctagtttccgtcgctttggccctttgattgtg
gattggcctcataaggcagagagcaaatcttattttccaccaaaaggctatgcattcctg
ctgtttcaagatgaaagttctgttcaggctctcattgatgcatgtattgaagaagatgga
aaactttacctgtgtgtatcaagtccaaccatcaaggataaaccagtgcagatccggccc
tggaatctcagtgacagtgactttgtgatggatggctcacagccacttgacccacggaaa
acaatatttgttggtggtgttcctcgaccattacgagctgtggagcttgcaatgataatg
gatcggctgtatggaggcgtctgctatgctggaatcgatactgacccagagctcaaatac
ccaaaaggagctggaagagtcgcgttttctaatcaacagagttacatagctgctatcagt
gcccgctttgttcagctgcagcatggagagatagataaacgggtggaggttaagccatat
gtcttggatgaccagctgtgtgatgaatgtcaaggggcccgttgtggggggaaatttgct
ccatttttctgtgctaatgttacctgtctgcagtattactgtgaatattgctgggctgct
attcactctcgtgctggcagagaattccacaagcccctggtgaaggaaggtggtgaccgc
cctcggcatatttcattccgctggaactga

DBGET integrated database retrieval system