KEGG   Mus musculus (mouse): 12889
Entry
12889             CDS       T01002                                 

Symbol
Cplx1, 921-, 921-S
Name
(RefSeq) complexin 1
  KO
K15294  complexin-1/2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    12889 (Cplx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12889 (Cplx1)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Syntaxin-binding proteins
    12889 (Cplx1)
SSDB
Motif
Pfam: Synaphin
Other DBs
NCBI-GeneID: 12889
NCBI-ProteinID: NP_031782
MGI: 104727
Ensembl: ENSMUSG00000033615
Vega: OTTMUSG00000028893
UniProt: P63040
Position
5; 5 F
AA seq 134 aa
MEFVMKQALGGATKDMGKMLGGDEEKDPDAAKKEEERQEALRQAEEERKAKYAKMEAERE
VMRQGIRDKYGIKKKEEREAEAQAAMEANSEGSLTRPKKAIPPGCGDEPEEEDESILDTV
IKYLPGPLQDMFKK
NT seq 405 nt   +upstreamnt  +downstreamnt
atggagttcgtgatgaaacaagccctgggaggggccaccaaggacatggggaagatgctt
gggggtgatgaggaaaaggaccccgatgctgctaagaaggaggaagagcggcaggaggca
ctgcggcaggcagaggaggagcgcaaagcaaagtacgccaagatggaggcagaacgtgag
gtcatgcggcagggtataagagacaagtatggcatcaagaagaaggaggagcgtgaggct
gaggctcaggcagccatggaggccaactcggaaggcagcctgactcgacccaagaaggct
atcccaccgggctgtggcgatgagccagaggaggaagatgagagcatcctggacactgtc
atcaagtacctgcctgggccactgcaggacatgttcaagaagtaa

DBGET integrated database retrieval system