KEGG   Mus musculus (mouse): 12894Help
Entry
12894             CDS       T01002                                 

Gene name
Cpt1a, C730027G07, CPTI, Cpt1
Definition
(RefSeq) carnitine palmitoyltransferase 1a, liver
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00071  Fatty acid degradation
mmu01212  Fatty acid metabolism
mmu03320  PPAR signaling pathway
mmu04152  AMPK signaling pathway
mmu04714  Thermogenesis
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    12894 (Cpt1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    12894 (Cpt1a)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    12894 (Cpt1a)
   04920 Adipocytokine signaling pathway
    12894 (Cpt1a)
   03320 PPAR signaling pathway
    12894 (Cpt1a)
  09159 Environmental adaptation
   04714 Thermogenesis
    12894 (Cpt1a)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    12894 (Cpt1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12894 (Cpt1a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     12894 (Cpt1a)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    12894 (Cpt1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 12894
NCBI-ProteinID: NP_038523
MGI: 1098296
Ensembl: ENSMUSG00000024900
UniProt: P97742 Q7TQD5 Q3UGT1
Position
19 A; 19 3.08 cM
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALKQICLSGLHSWKKKFIRFKNGIITGVFPASPS
SWLIVVVGVISSMHTKVDPSLGMIAKINRTLDTTGRMSSQTKNIVSGVLFGTGLWVAIIM
TMRYSLKVLLSYHGWMFAEHGKMSRSTRIWMAMVKVFSGRKPMLYSFQTSLPRLPVPAVK
DTVSRYLESVRPLMKEGDFQRMTALAQDFAVNLGPKLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPIMVNSNYYAMEMLYITPTHIQAARAGNTIHAILLYRRTVDREELKPIRLLGST
IPLCSAQWERLFNTSRIPGEETDTIQHVKDSRHIVVYHRGRYFKVWLYHDGRLLRPRELE
QQMQQILDDTSEPQPGEAKLAALTAADRVPWAKCRQTYFARGKNKQSLDAVEKAAFFVTL
DESEQGYREEDPEASIDSYAKSLLHGRCFDRWFDKSITFVVFKNSKIGINAEHSWADAPI
VGHLWEYVMATDVFQLGYSEDGHCKGDKNPNIPKPTRLQWDIPGECQEVIETSLSSASFL
ANDVDLHSFPFDTFGKGLIKKCRTSPDAFIQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTTESCNFVLAMMDPTTTAEQRFKLFKIACEKHQHLYRLAMTGAGIDRHLFCL
YVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFDFEKYPDYVSCGGGFGPVADDGY
GVSYIIVGENFIHFHISSKFSSPETDSHRFGKHLRQAMMDIITLFGLTANSKK
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggctcaccaagctgtggccttccagttcacagtcacccctgatggcatcgat
ctccgcctgagccatgaagccctcaaacagatctgcctgtcagggctgcactcctggaag
aagaagttcatccgattcaagaatggcatcatcactggtgtgttccccgcgagtccctcc
agctggcttatcgtggtggtgggtgtgatatcatccatgcataccaaagtggacccctcc
ctgggcatgattgcaaagatcaatcggaccctagacaccactggccgcatgtcaagccag
acgaagaacatcgtgagtggcgtcctctttggcacagggctctgggtggcgatcatcatg
actatgcgctactcgctgaaggtgctgctctcctaccatggctggatgtttgcagagcac
ggcaaaatgagccgcagcaccagaatctggatggctatggtcaaggtcttctcgggtcga
aagcccatgttgtacagcttccagacgtctctgccgcgcctgcctgtcccagctgtcaaa
gataccgtgagcaggtacctggagtctgtgaggccactgatgaaggagggagacttccaa
cgcatgacagcactggcccaggattttgctgtcaaccttggacccaaattgcagtggtat
ttgaagctaaaatcctggtgggccacaaattatgtgagtgactggtgggaggaatacatc
tacctgcggggccgagggccgatcatggttaacagcaactactacgccatggagatgctc
tacatcaccccaacccatattcaggcagcgagagctggcaacaccatccacgccatactg
ctgtatcgtcgcacggtagaccgtgaggaactcaaacctattcgtcttctgggatctaca
attcccctctgctctgctcagtgggagcgactcttcaatacttcccgcatccctggggag
gagacagacaccatccaacacgtcaaggacagcaggcacattgtcgtgtaccacagaggc
cgttacttcaaggtctggctctaccatgacgggaggctgctgaggccccgtgagctggag
cagcagatgcagcagatcctggatgacacctcagagccgcagcccggggaagccaagctt
gccgccctcactgccgcagacagagtgccctgggcgaagtgtcggcagacctattttgca
cgaggaaaaaataagcaatctctggatgcggtagaaaaggcagcattcttcgtgacgttg
gacgaatcggaacagggatatagagaggaggaccctgaggcatctattgacagctatgcc
aaatctctgctgcatggtagatgtttcgacaggtggtttgacaagtccatcacctttgtt
gtcttcaaaaacagcaagataggcataaacgcagagcattcctgggcggacgcgcccatc
gtgggccatctgtgggagtatgtcatggccaccgacgtcttccagctgggctactcagag
gatggacactgtaaaggagacaagaaccccaacatccccaaacccaccaggctacagtgg
gacattccaggagaatgccaggaggtcatagagacatccctaagcagtgccagttttttg
gcaaatgatgtggacctgcattccttcccatttgacacctttggcaaaggcttgatcaag
aagtgccggacgagtcccgatgccttcatccagctggcactgcagctcgcacattacaag
gacatgggcaagttctgcctcacgtatgaggcttccatgactcggctcttccgagagggg
aggacagagactgtacgctcctgcactacggagtcctgcaactttgtgctggccatgatg
gaccccacaacaacggcagagcagaggttcaagctgttcaagatagcttgtgaaaagcac
cagcacctgtaccgcctcgccatgacgggcgctggcatcgaccgccacctcttctgcctc
tatgtggtgtccaagtatctggcagtcgactcacctttcctgaaggaggtactgtctgag
ccatggaggttgtccacgagccagactcctcagcagcaggtggaactgtttgactttgag
aaataccctgactatgtgtcctgtggcgggggctttgggccggttgctgatgacggctat
ggtgtttcctacattattgtgggagagaatttcatccacttccatatttcttccaagttc
tctagccctgagacagactcacaccgctttgggaagcacttgagacaagccatgatggac
attatcaccttgtttggcctcaccgccaattccaaaaagtaa

DBGET integrated database retrieval system