KEGG   Mus musculus (mouse): 12902
Entry
12902             CDS       T01002                                 

Gene name
Cr2, C3D, C3DR, CD21, CD35, Cr, Cr-, Cr-1, Cr-2, Cr1
Definition
(RefSeq) complement receptor 2
  KO
K04012  complement receptor type 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04640  Hematopoietic cell lineage
mmu04662  B cell receptor signaling pathway
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12902 (Cr2)
   04610 Complement and coagulation cascades
    12902 (Cr2)
   04662 B cell receptor signaling pathway
    12902 (Cr2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    12902 (Cr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12902 (Cr2)
CD molecules [BR:mmu04090]
 Proteins
  12902 (Cr2)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 12902
NCBI-ProteinID: NP_001355694
MGI: 88489
Ensembl: ENSMUSG00000026616
Vega: OTTMUSG00000050897
Position
1 H6; 1 98.44 cM
AA seq 1408 aa
MGSLGSLWVFFTLITPGVLGQCKLLPKYSFAKPSIVSDKSEFAIGTTWEYKCRPGYFRKS
FIITCLETSKWSDAQQFCKRKPCMNPQEPLHGSVHINTGIEFGSTITYSCNQGYRLIGDS
SATCIVSDNTVMWDNDMPLCESIPCESPPAISNGDFYSSSRDSFFYGMVVTYYCHTGKNR
EKLFDLVGEKSIYCTSKDNQVGIWNSPPPQCIPRVKCPMPEIENGLVESGFKHSFFLNDT
VIFKCKSGFTMKGSRIAWCQPNSKWSPPLPTCFMGCLPPQNILHGDYNKKDEFFSVGQKV
SYSCNPGYTLIGTNLVECTSLGTWSNTVPTCEVKSCDAIPNHLLHGRVFLPPNLQLGAEV
SFVCDLGFQLKGKPSSQCIPEGETVIWNNKFPVCEQISCDPPPEVKNARKPYYSLPIVPG
TVLRYTCSPSYRLIGEKAIFCISENQVHATWDKAPPICESVNKTISCSDPIVPGGFMNKG
SKAPFRHGDSVTFTCKANFTMKGSKTVWCQANEMWGPTALPVCESDFPLECPSLPTIHNG
HHTGQHVDQFVAGLSVTYSCEPGYLLTGKKTIKCLSSGDWDGVIPTCKEAQCEHPGKFPN
GQVKEPLSLQVGTTVYFSCNEGYQLQGQPSSQCVIVEQKAIWTKKPVCKEILCPPPPPVR
NGSHTGSFSENVPYGSTVTYTCDPSPEKGVSFTLIGEKTINCTTGSQKTGIWSGPAPYCV
LSTSAVLCLQPKIKRGQILSILKDSYSYNDTVAFSCEPGFTLKGNRSIRCNAHGTWEPPV
PVCEKGCQAPPKIINGQKEDSYLLNFDPGTSIRYSCDPGYLLVGEDTIHCTPEGKWTPIT
PQCTVAECKPVGPHLFKRPQNQFIRTAVNSSCDEGFQLSESAYQLCQGTIPWFIEIRLCK
EITCPPPPVIHNGTHTWSSSEDVPYGTVVTYMCYPGPEEGVKFKLIGEQTIHCTSDSRGR
GSWSSPAPLCKLSLPAVQCTDVHVENGVKLTDNKAPYFYNDSVMFKCDDGYILSGSSQIR
CKANNTWDPEKPLCKKEGCEPMRVHGLPDDSHIKLVKRTCQNGYQLTGYTYEKCQNAENG
TWFKKIEVCTVILCQPPPKIANGGHTGMMAKHFLYGNEVSYECDEGFYLLGEKSLQCVND
SKGHGSWSGPPPQCLQSSPLTHCPDPEVKHGYKLNKTHSAFSHNDIVHFVCNQGFIMNGS
HLIRCHTNNTWLPGVPTCIRKASLGCQSPSTIPNGNHTGGSIARFPPGMSVMYSCYQGFL
MAGEARLICTHEGTWSQPPPFCKEVNCSFPEDTNGIQKGFQPGKTYRFGATVTLECEDGY
TLEGSPQSQCQDDSQWNPPLALCKYRSTIPLICGISVGSALIILMSVGFCMILKHRESNY
YTKTRPKEGALHLETREVYSIDPYNPAS
NT seq 4227 nt   +upstreamnt  +downstreamnt
atgggatccttgggttcgctctgggttttcttcactctcatcactccaggagttcttggt
cagtgtaagttgctgccaaagtattcttttgctaaaccttctattgtgagtgataaatct
gagtttgccattggaacaacttgggaatacaaatgtcgccctgggtattttaggaagtca
tttattatcacctgcttagaaacctccaagtggtcagatgctcagcagttctgtaaacgt
aaaccatgtatgaatcctcaagaacccctccatggttctgtgcatataaacacgggtatc
gagtttgggtcaacaattacgtattcttgtaatcaaggatatcgactcattggtgactcg
tctgctacatgtattgtatcagacaatactgtaatgtgggataatgatatgcctctttgt
gaatctattccttgtgagtcacctccagccatctccaatggagacttctacagcagcagc
agagacagctttttctatgggatggtagtaacttattattgccataccggaaagaatagg
gaaaaactgtttgatctggtgggtgagaagtcaatatattgtaccagcaaagacaatcaa
gttggcatctggaatagtccacctcctcagtgtattcctagagtcaagtgcccaatgcca
gaaattgaaaatggactagtggagtctggatttaaacactccttcttcttaaatgataca
gtaatatttaagtgcaaatctggctttaccatgaaaggcagcagaatagcatggtgccag
ccaaacagcaaatggagccctccattgccaacatgcttcatgggatgtctaccacctcaa
aatatcctccatggtgattataacaaaaaggatgagttcttctctgttggccagaaagtg
tcatatagctgtaaccctggctatactctcattggaactaacctcgtggagtgtacatcc
ttgggaacctggagcaatacagtcccgacatgtgaagtgaaatcatgtgatgcaattcca
aaccatcttctccatggccgtgtgtttcttccccctaatctccagcttggggcagaggtt
tcctttgtttgtgacttagggttccagttaaaaggcaaaccttctagtcagtgtatccca
gaaggagagacagtaatctggaataataagtttcctgtctgtgaacagatttcttgtgac
cctcctcctgaagtcaaaaatgctcggaaaccctattattctcttcccatagttcctgga
actgttctgaggtacacttgttcacctagctaccgcctcattggagaaaaggctatcttt
tgtataagtgaaaatcaagtgcatgccacctgggataaagctcctcctatatgtgaatct
gtgaataaaaccatttcttgctcagatcccatagtaccagggggattcatgaataaagga
tctaaggcaccattcagacatggtgattctgtgacatttacctgtaaagccaacttcacc
atgaaaggaagcaaaactgtctggtgccaggcaaatgaaatgtggggaccaacagctctg
ccagtctgtgagagtgatttccctctggagtgcccatcacttccaacgattcataatgga
caccacacaggacagcatgttgaccagtttgttgcggggttgtctgtgacatacagttgt
gaacctggctatttgctcactggaaaaaagacaattaagtgcttatcttcaggagactgg
gatggtgtcatcccgacatgcaaagaggcccagtgtgaacatccaggaaagtttcccaat
gggcaggtaaaggaacctctgagccttcaggttggcacaactgtgtacttctcctgtaat
gaagggtaccaattacaaggacaaccctctagtcagtgtgtaattgttgaacagaaagcc
atctggactaagaagccagtatgtaaagaaattctctgcccaccacctccacctgttcgt
aatggaagtcatacaggcagcttttcagaaaatgtaccatatggaagcacagttacctac
acctgtgacccaagcccagagaaaggcgtgagcttcactcttattggagagaagactatc
aattgtactactggtagtcagaagactgggatctggagtggccctgctccatattgtgta
ctttcaacttctgcagttctgtgtttacaaccgaagatcaaaagagggcaaatattatct
attttgaaagatagttattcatataatgacactgtggcattttcttgtgaacctggcttc
accttgaagggcaacaggagcattcgatgcaatgctcatggcacatgggagccaccggta
ccagtgtgtgaaaaaggatgtcaggctcctcctaaaattatcaatgggcaaaaagaagat
agttacttgctcaactttgaccctggtacatccataagatatagctgtgaccctggctat
ttactggtgggagaggacactatacattgcacccctgaggggaagtggacacccattact
ccccagtgcacagttgcagagtgtaagccagtaggaccacatctctttaagaggcctcag
aatcagtttattaggacagctgttaattcttcttgtgatgaagggttccagttaagtgag
agtgcttatcaactgtgtcaaggtacaattccttggtttatagaaatccgtctttgtaaa
gaaatcacctgcccaccacctcctgttatacacaacgggacacatacatggagttcctca
gaagatgtcccatatggaactgtggtcacatacatgtgctatcctgggccagaggaaggc
gtaaaattcaaactcatcggggagcaaaccatccactgtacaagtgacagcagaggaaga
ggctcctggagtagccctgctcctctctgtaaactttccctcccagctgtccagtgcaca
gacgttcatgttgaaaatggagtcaagctcactgacaataaagccccatatttctacaat
gatagtgtgatgttcaagtgtgatgatggatatattttgagtggaagcagtcagatccgg
tgtaaagccaataatacctgggatcctgaaaaaccactttgtaaaaaagaaggatgtgag
cctatgagagtacatggccttccagatgattcacatataaaactagtgaaaagaacctgt
caaaatgggtaccagttgactggatatacttatgagaagtgtcaaaatgctgagaatggg
acttggtttaaaaagattgaagtttgtacagttattctctgtcaacctccaccaaaaatt
gcaaatggtggtcacacaggcatgatggcaaagcacttcctatatggaaatgaagtttct
tatgaatgtgatgaagggttctatcttttgggagagaaaagtttgcagtgcgtaaatgat
tctaaaggtcatggctcttggagtggacctccaccacaatgcttacaatcttctcctcta
actcattgccccgatccagaagtcaaacatggttacaaactcaataaaactcattctgca
ttttctcataatgacatagtacattttgtctgcaatcaaggcttcatcatgaacggcagc
cacttgataaggtgtcatactaataacacatggttaccaggtgtaccaacttgtatcaga
aaggcttctttagggtgtcagtctccatccacaatccccaatgggaatcatactggtggg
agtatagctcgatttccccctggaatgtcagtcatgtacagttgctaccaaggcttcctt
atggctggagaggcacgtcttatctgtactcatgagggtacctggagtcaacctccccct
ttttgcaaagaggtaaactgtagcttccctgaagatacaaatggaatccagaagggattt
caacctgggaaaacctatcgatttggggctactgtgactctggaatgtgaggatgggtat
accttggagggaagtccccagagccagtgccaggatgacagccaatggaaccctcccttg
gctctttgcaaataccggtcaactattcctcttatttgtggtatttctgtgggctcagca
cttatcattttgatgagtgtcggcttctgtatgatattaaaacacagagaaagcaattat
tatacaaagacaagacccaaagaaggagctcttcatttagaaacacgagaagtatattct
attgatccatataacccagcaagctga

DBGET integrated database retrieval system