KEGG   Mus musculus (mouse): 12904
Entry
12904             CDS       T01002                                 

Gene name
Crabp2, AI893628, Cr, Crab, Crabp-2, CrabpII
Definition
(RefSeq) cellular retinoic acid binding protein II
  KO
K17289  cellular retinoic acid-binding protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12904 (Crabp2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   12904 (Crabp2)
SSDB
Motif
Pfam: Lipocalin Lipocalin_7 Spore_YunB
Other DBs
NCBI-GeneID: 12904
NCBI-ProteinID: NP_031785
MGI: 88491
Ensembl: ENSMUSG00000004885
Vega: OTTMUSG00000027199
UniProt: P22935
Position
3 F1; 3
AA seq 138 aa
MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDTFYIKTSTTVR
TTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGEL
ILTMTADDVVCTRVYVRE
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcctaacttttctggcaactggaagatcatccgatcggaaaactttgaggaaatgcta
aaagctctgggggtgaacatgatgatgaggaagatcgctgtggctgcagcctccaagcca
gcagtcgagatcaaacaggagaatgacactttctacatcaaaacctccaccactgtgcga
accacggagattaacttcaagatcggggaggaatttgaggagcagaccgtggatgggaga
ccctgtaagagtttggtgaaatgggagagtggaaacaaaatggtgtgcgagcagaggctt
ctgaagggggagggccccaagacctcctggagccgagaactgaccaatgatggagagctg
atcctgacaatgacagcagatgacgttgtgtgcaccagggtctacgtccgagagtga

DBGET integrated database retrieval system