KEGG   Mus musculus (mouse): 12908
Entry
12908             CDS       T01002                                 

Gene name
Crat, AW107812, CA, CARAT
Definition
(RefSeq) carnitine acetyltransferase
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    12908 (Crat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     12908 (Crat)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 12908
NCBI-ProteinID: NP_031786
MGI: 109501
Ensembl: ENSMUSG00000026853
Vega: OTTMUSG00000016795
UniProt: P47934
Structure
PDB: 

Position
2 B; 2 21.69 cM
AA seq 626 aa
MLAFAARTVVKPLGLLKPSSLMKVSGRFKAHQDALPRLPVPPLQQSLDYYLKALQPIVSE
EEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQFRQPVVIYSSP
GVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLGGQPLCMNQYYQILSSC
RVPGPKQDSVVNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWNSS
LQSNKEPVGILTSNHRNTWAKAYNNLIKDKVNRESVNSIQKSIFTVCLDKQVPRVSDDVY
RNHVAGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGPPIVALVDHVME
YTKKPELVRSPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKD
FPKSEKLSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVK
GMGDSTVPEQQKVELLRKAVQAHRAYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNA
ARMAHYLEKALLDMRTLLQNHPRAKL
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgttagcctttgctgccagaaccgtggtaaaacccctgggcctcctcaagccctcctcc
ttgatgaaggtttctggtcgcttcaaggcccaccaagatgcactgccaaggctgcctgtg
cccccacttcagcaatccctggactattacctcaaggcactgcagcccatcgtgagtgag
gaagaatgggctcacaccaagcaactggtggatgagtttcagacctcagggggcgtaggg
gaacgcctacagaagggactggagcgcagggccaagaaaatggagaactggctgtccgag
tggtggctcaagacagcctatctccagttccgccagcctgtggtcatctactccagccca
ggagtgatcctgcccaagcaggactttgtggatctacagggtcagcttcggtttgctgcc
aaactcatcgagggtgtattggatttcaagtccatgattgacaatgagacgctgccagtt
gagttcctgggaggacagccgctgtgcatgaaccagtattatcagatcctgtcttcttgc
cgtgtgcccggccccaagcaggactcagtggtgaacttcttaaagtcaaagagaccaccc
acgcatataaccgtggtgcataactaccagttcttcgagctggatgtgtaccacagtgac
ggaacaccgctcacctcagatcagatctttgtgcagctagagaaaatatggaattcctca
ctgcaatccaacaaagagcctgttggcatcctaacctccaaccaccgaaacacctgggcc
aaggcctacaacaacctcattaaagacaaagttaaccgagagtcagtgaactccatacag
aagagcatcttcaccgtgtgcctggacaagcaagtgcctagagtctcagatgatgtctac
cgaaaccacgtagcaggccagatgctacatggtggtggtagcaagttcaacagtggcaac
cgctggtttgacaagacactgcagttcatcgtggcagaagacggctcctgtgggatggtg
tatgagcatgcagctgcagaagggccccccatagttgcacttgtggaccatgtcatggag
tatacaaaaaagcctgagcttgtgcggtctcctatggtgcccttgccaatgcccaagaag
ctgcggttcaacatcacacctgagatcaagaacgacatagagaaagccaaacagaacctc
agcatcatgatccaggacctggacatcatgatgctgacgttccatcactttggaaaggac
ttccccaagtccgagaagctaagccctgatgccttcatccaggtagccctgcagctggca
tactacaggatctatgggcaggcgtgtgccacgtatgaaagtgcctctctgcgcatgttt
cacctgggccgcactgacaccatccgctcagcctccatagactcgctggcctttgtcaaa
ggcatgggtgactccacagtgccggagcagcagaaggtggagctgctccggaaggctgtg
caggcccaccgagcctacactgaccgggccatccgaggggaggcctttgaccggcacctg
ctgggtctgaagctgcaggccatcgaggacctggtcagcatgcctgacatcttcatggac
acctcttacgccattgctatgcacttcaacctctctaccagccaggtccctgccaagaca
gactgtgtcatgttcttcggacctgtggtcccagatggttatggcatctgctacaacccc
atggaggcccatatcaacttctccgtgtcagcctacaacagctgtgctgagaccaacgct
gcccgcatggctcactacttggagaaagctctgctggacatgcgcaccctactccagaac
caccccagggccaagctctga

DBGET integrated database retrieval system