KEGG   Mus musculus (mouse): 12912
Entry
12912             CDS       T01002                                 

Gene name
Creb1, 2310001E10Rik, 3526402H21Rik, AV083133, Cre, Creb, Creb-, Creb-1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04380  Osteoclast differentiation
mmu04612  Antigen processing and presentation
mmu04668  TNF signaling pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
mmu04714  Thermogenesis
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04931  Insulin resistance
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04962  Vasopressin-regulated water reabsorption
mmu05016  Huntington disease
mmu05020  Prion disease
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12912 (Creb1)
   04024 cAMP signaling pathway
    12912 (Creb1)
   04022 cGMP-PKG signaling pathway
    12912 (Creb1)
   04151 PI3K-Akt signaling pathway
    12912 (Creb1)
   04152 AMPK signaling pathway
    12912 (Creb1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12912 (Creb1)
  09152 Endocrine system
   04911 Insulin secretion
    12912 (Creb1)
   04922 Glucagon signaling pathway
    12912 (Creb1)
   04915 Estrogen signaling pathway
    12912 (Creb1)
   04926 Relaxin signaling pathway
    12912 (Creb1)
   04935 Growth hormone synthesis, secretion and action
    12912 (Creb1)
   04918 Thyroid hormone synthesis
    12912 (Creb1)
   04928 Parathyroid hormone synthesis, secretion and action
    12912 (Creb1)
   04916 Melanogenesis
    12912 (Creb1)
   04924 Renin secretion
    12912 (Creb1)
   04925 Aldosterone synthesis and secretion
    12912 (Creb1)
   04927 Cortisol synthesis and secretion
    12912 (Creb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    12912 (Creb1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    12912 (Creb1)
  09156 Nervous system
   04725 Cholinergic synapse
    12912 (Creb1)
   04728 Dopaminergic synapse
    12912 (Creb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12912 (Creb1)
  09149 Aging
   04211 Longevity regulating pathway
    12912 (Creb1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    12912 (Creb1)
   04713 Circadian entrainment
    12912 (Creb1)
   04714 Thermogenesis
    12912 (Creb1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12912 (Creb1)
  09162 Cancer: specific types
   05215 Prostate cancer
    12912 (Creb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12912 (Creb1)
   05161 Hepatitis B
    12912 (Creb1)
   05163 Human cytomegalovirus infection
    12912 (Creb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12912 (Creb1)
   05165 Human papillomavirus infection
    12912 (Creb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12912 (Creb1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    12912 (Creb1)
   05020 Prion disease
    12912 (Creb1)
  09165 Substance dependence
   05030 Cocaine addiction
    12912 (Creb1)
   05031 Amphetamine addiction
    12912 (Creb1)
   05034 Alcoholism
    12912 (Creb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    12912 (Creb1)
   04934 Cushing syndrome
    12912 (Creb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12912 (Creb1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12912 (Creb1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    12912 (Creb1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    12912 (Creb1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf HNF-1A_C
Other DBs
NCBI-GeneID: 12912
NCBI-ProteinID: NP_598589
MGI: 88494
Ensembl: ENSMUSG00000025958
Vega: OTTMUSG00000047617
UniProt: Q01147 Q543W0
Position
1 C2; 1 32.74 cM
AA seq 327 aa
MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
NT seq 984 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagacaaccagcagagtggagatgctgctgtaacagaagct
gaaaatcaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatcc
atgccagcagctcatgcaacatcatctgctcccactgtaaccttagtgcagctgcccaat
gggcagacagtccaggtccatggcgttatccaggcggcccagccatcagttatccagtct
ccacaagtccaaacagttcagatttcaactattgcagaaagtgaagattcacaggagtct
gtggatagtgtaactgattcccaaaaacgaagggaaatcctttcaaggaggccttcctac
aggaaaattttgaatgacttatcttctgatgcaccaggggtgccaaggattgaagaagaa
aagtcagaagaggagacttcagcccctgccatcaccactgtaacagtgccaacccccatt
taccaaactagcagtgggcagtacattgccattacccagggaggagcaatacagctggct
aacaatggtacggatggggtacagggcctgcagacattaaccatgaccaatgcagctgcc
actcagccgggtactaccattctacagtatgcacagaccactgatggacagcagattcta
gtgcccagcaaccaagttgttgttcaagctgcctcaggcgatgtacaaacataccagatc
cgcacagcacccacgagcaccattgcccctggagttgttatggcgtcctccccagcactt
cctacacagcctgctgaagaagcagcacggaagagagaggtccgtctaatgaagaacagg
gaggcagcaagagaatgtcgtagaaagaagaaagaatatgtgaaatgtttagagaacaga
gtggcagtgcttgaaaaccaaaacaaaacattgattgaggagctaaaagcacttaaggac
ctttactgccacaaatcagattaa

DBGET integrated database retrieval system