KEGG   Mus musculus (mouse): 12914
Entry
12914             CDS       T01002                                 

Gene name
Crebbp, AW558298, CB, CBP, CBP/p300, KAT, KAT3A, p300/CBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04520  Adherens junction
mmu04630  JAK-STAT signaling pathway
mmu04720  Long-term potentiation
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04922  Glucagon signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05016  Huntington disease
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12914 (Crebbp)
   04330 Notch signaling pathway
    12914 (Crebbp)
   04350 TGF-beta signaling pathway
    12914 (Crebbp)
   04630 JAK-STAT signaling pathway
    12914 (Crebbp)
   04066 HIF-1 signaling pathway
    12914 (Crebbp)
   04068 FoxO signaling pathway
    12914 (Crebbp)
   04024 cAMP signaling pathway
    12914 (Crebbp)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12914 (Crebbp)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    12914 (Crebbp)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    12914 (Crebbp)
   04935 Growth hormone synthesis, secretion and action
    12914 (Crebbp)
   04919 Thyroid hormone signaling pathway
    12914 (Crebbp)
   04916 Melanogenesis
    12914 (Crebbp)
  09156 Nervous system
   04720 Long-term potentiation
    12914 (Crebbp)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12914 (Crebbp)
   05206 MicroRNAs in cancer
    12914 (Crebbp)
   05203 Viral carcinogenesis
    12914 (Crebbp)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    12914 (Crebbp)
   05215 Prostate cancer
    12914 (Crebbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12914 (Crebbp)
   05161 Hepatitis B
    12914 (Crebbp)
   05164 Influenza A
    12914 (Crebbp)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12914 (Crebbp)
   05165 Human papillomavirus infection
    12914 (Crebbp)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    12914 (Crebbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    12914 (Crebbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12914 (Crebbp)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12914 (Crebbp)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12914 (Crebbp)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     12914 (Crebbp)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    12914 (Crebbp)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    12914 (Crebbp)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    12914 (Crebbp)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 12914
NCBI-ProteinID: NP_001020603
MGI: 1098280
Ensembl: ENSMUSG00000022521
Vega: OTTMUSG00000048175
UniProt: Q6GQV9 F8VPR5
Structure
PDB: 

Position
16 A1; 16 2.4 cM
AA seq 2441 aa
MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKS
PLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGATSSVLAE
TLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQ
SMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSM
QRAYAALGLPYMNQPQTQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQQ
PPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSTGVRKGWHEHVTQDLR
SHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKI
QKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQGM
NSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHAN
NIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGAALPNPLNMLAP
QASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQTP
TPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPGT
PLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVQTDDAEPEPTESKGEPRS
EMMEEDLQGSSQVKEETDTTEQKSEPMEVEEKKPEVKVEAKEEEENSSNDTASQSTSPSQ
PRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIK
RKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYC
CGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQ
TTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPR
KENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRF
VDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHF
FRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRL
QEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQE
EEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQ
KLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFS
SLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHT
HKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMK
RVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHRL
QQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSPA
GFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANINN
GMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRPV
MSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAA
FIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQP
AMGGLNPQGQALNIMNPGHNPNMTNMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQNSAS
LAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPGLGA
DSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSN
QVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQGHLG
NPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7326 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctccgcgaatgacaacacagattttggatcattgtttgacttggaaaatgacctt
cctgatgagctgatccccaatggagaattaagccttttaaacagtgggaaccttgttcca
gatgctgcgtccaaacataaacaactgtcagagcttcttagaggaggcagcggctctagc
atcaacccagggataggcaatgtgagtgccagcagccctgtgcaacagggccttggtggc
caggctcaggggcagccgaacagtacaaacatggccagcttaggtgccatgggcaagagc
cctctgaaccaaggagactcatcaacacccaacctgcccaaacaggcagccagcacctct
gggcccactccccctgcctcccaagcactgaatccacaagcacaaaagcaagtagggctg
gtgaccagtagtcctgccacatcacagactggacctgggatctgcatgaatgctaacttc
aaccagacccacccaggccttctcaatagtaactctggccatagcttaatgaatcaggct
caacaagggcaagctcaagtcatgaatggatctcttggggctgctggaagaggaagggga
gctggaatgccctaccctgctccagccatgcagggggccacaagcagtgtgctggcggag
accttgacacaggtttccccacaaatggctggccatgctggactaaatacagcacaggca
ggaggcatgaccaagatgggaatgactggtaccacaagtccatttggacaaccctttagt
caaactggagggcagcagatgggagccactggagtgaacccccagttagccagcaaacag
agcatggtcaatagtttacctgcttttcctacagatatcaagaatacttcagtcaccact
gtgccaaatatgtcccagttgcaaacatcagtgggaattgtacccacacaagcaattgca
acaggccccacagcagaccctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcatgcccacaaatgtcagagacgagagcaagcaaatggagaggttcgagcctgttct
ctcccacactgtcgaaccatgaaaaacgttttgaatcacatgacacattgtcaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctgggatctccagctagtggaattcaaaacacaattggttctgttggt
gcagggcaacagaatgccacttccttaagtaacccaaatcccatagaccccagttccatg
cagcgggcctatgctgctctaggactcccctacatgaaccagcctcagacgcagctgcag
cctcaggttcctggccagcaaccagcacagcctccagcccaccagcagatgaggactctc
aatgccctaggaaacaaccccatgagtatcccagcaggaggaataacaacagatcaacag
ccaccaaacttgatttcagaatcagctcttccaacttccttgggggctaccaatccactg
atgaatgatggttcaaactctggtaacattggaagcctcagcacgatacctacagcagcg
cctccttccagcactggtgttcgaaaaggctggcatgaacatgtgactcaggacctacgg
agtcatctagtccataaactcgttcaagccatcttcccaactccagaccctgcagctctg
aaagatcgccgcatggagaacctggttgcctatgctaagaaagtggagggagacatgtat
gagtctgctaatagcagggatgaatactatcatttattagcagagaaaatctataaaata
caaaaagaactagaagaaaagcggaggtcacgtttacataagcaaggcatcctgggtaac
cagccagctttaccagcttctggggctcagccccctgtgattccaccagcccagtctgta
agacctccaaatgggcccctgcctttgccagtgaatcgcatgcaggtttctcaagggatg
aattcatttaacccaatgtccctgggaaacgtccagttgccacaggcacccatgggacct
cgtgcagcctcccctatgaaccactctgtgcagatgaacagcatggcctcagttccgggt
atggccatttctccttcacggatgcctcagcctccaaatatgatgggcactcatgccaac
aacattatggcccaggcacctactcagaaccagtttctgccacagaaccagtttccatca
tccagtggggcaatgagtgtgaacagtgtgggcatggggcaaccagcagcccaggcaggt
gtttcacagggtcaggtacctggagctgctctccctaaccctctgaacatgctggcaccc
caggccagccagctgccttgcccaccagtgacacagtcaccattgcacccgactccacct
cctgcttccacagctgctggcatgccctctctccaacatccaacggcaccaggaatgacc
cctcctcagccagcagctcccactcagccatctactcctgtgtcatctgggcagactcct
accccaactcctggctcagtgcccagcgctgcccaaacacagagtacccctacagtccag
gcagcagcacaggctcaggtgactccacagcctcagaccccagtgcagccaccatctgtg
gctactcctcagtcatcacagcagcaaccaacgcctgtgcatactcagcctcctggcaca
ccgctttctcaggcagcagccagcattgataatagagtccctactccctcctctgtgacc
agtgctgaaaccagttcccagcagccaggacccgatgtgcccatgctggaaatgaagaca
gaggtgcagacagatgatgctgagcctgaacctactgaatccaagggggaacctcggtct
gagatgatggaagaggatttacaaggttcttcccaagtaaaagaagagacagatacgaca
gagcagaagtcagagccaatggaagtagaagaaaagaaacctgaagtaaaagtggaagct
aaagaggaagaagagaacagttcgaacgacacagcctcacaatcaacatctccttcccag
ccacgcaaaaaaatctttaaacccgaggagctacgccaggcacttatgccaactctagaa
gcactctatcgacaggacccagagtctttgccttttcgtcagcctgtagatcctcagctc
ctaggaatcccagattattttgatatagtgaagaatcctatggacctttctaccatcaaa
cgaaagctggacacagggcaatatcaagaaccctggcagtatgtggatgatgtctggctt
atgttcaacaatgcgtggctatataatcgtaaaacgtcccgtgtatataaattttgcagt
aaacttgcagaggtctttgaacaagaaattgaccctgtcatgcagtctcttggatattgc
tgtggacgaaagtatgagttctccccacagactttgtgctgttacggaaagcagctgtgt
acaattcctcgtgatgcagcctactacagctatcagaataggtatcatttctgtgagaag
tgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacctcag
acgacaatttccaaggatcaatttgaaaagaagaaaaatgataccttagatcctgaacct
tttgttgactgcaaagagtgtggccggaagatgcatcagatttgtgttctacactatgac
atcatttggccttcaggttttgtgtgtgacaactgtttgaagaaaactggcagacctcgg
aaagaaaacaaattcagtgctaagaggctgcagaccacacgattgggaaaccacttagaa
gacagagtgaataagtttttgcggcgccagaatcaccctgaagctggggaggtttttgtc
agagtggtggccagctcagacaagactgtggaggtcaagccgggaatgaagtcaaggttt
gtggattctggagagatgtcggaatctttcccatatcgtaccaaagcactctttgctttt
gaggagatcgatggagtcgatgtgtgcttttttgggatgcatgtgcaagaatacggctct
gattgccccccaccaaatacaaggcgtgtatacatatcttatctggacagtattcatttc
ttccggccccgctgcctccggacagctgtttaccatgagatcctcatcggatatctcgag
tatgtgaagaaattggggtatgtgacaggacatatttgggcctgtcccccaagtgaagga
gatgactatatctttcattgccacccccctgaccagaaaatccccaaaccaaaacgacta
caggagtggtacaagaagatgctggacaaggcgtttgcagagaggatcattaacgactat
aaggacatcttcaaacaagcgaacgaagacaggctcacgagtgccaaggagttgccctat
tttgaaggagatttctggcctaatgtgttggaagaaagcattaaggaactagaacaagaa
gaagaagaaaggaaaaaagaagagagtactgcagcgagtgagactcctgagggcagtcag
ggtgacagcaaaaatgcgaagaaaaagaacaacaagaagaccaacaaaaacaaaagcagc
attagccgcgccaacaagaagaagcccagcatgcccaatgtttccaacgacctgtcgcag
aagctgtatgccaccatggagaagcacaaggaggtattctttgtgattcatctgcatgct
gggcctgttatcagcactcagccccccatcgtggaccctgatcctctgcttagctgtgac
ctcatggatgggcgagatgccttcctcaccctggccagagacaagcactgggaattctct
tccttacgccgctccaaatggtccactctgtgcatgctggtggagctgcacacacagggc
caggaccgctttgtttatacctgcaatgagtgcaaacaccatgtggaaacacgctggcac
tgcactgtgtgtgaggactatgacctttgtatcaattgctacaacacaaagagccacacc
cataagatggtgaagtgggggctaggcctagatgatgagggcagcagtcagggtgagcca
cagtccaagagcccccaggaatcccggcgtctcagcatccagcgctgcatccagtccctg
gtgcatgcctgccagtgtcgcaatgccaactgctcactgccgtcttgccagaagatgaag
cgagtcgtgcagcacaccaagggctgcaagcgcaagactaatggaggatgcccagtgtgc
aagcagctcattgctctttgctgctaccacgccaaacactgccaagaaaataaatgccct
gtgcccttctgcctcaacatcaaacataagctccgccagcagcagatccagcatcgcctg
cagcaggctcagctcatgcgccggcgaatggcaaccatgaacacccgcaatgtgcctcag
cagagtttgccttctcctacctcagcaccacccgggactcctacacagcagcccagcaca
ccccaaacaccacagcccccagcccagcctcagccttcacctgttaacatgtcaccagct
ggcttccctaatgtagcccggactcagcccccaacaatagtgtctgctgggaagcctacc
aaccaggtgccagctcccccaccccctgcccagcccccacctgcagcagtagaagcagcc
cggcaaattgaacgtgaggcccagcagcagcagcacctataccgagcaaacatcaacaat
ggcatgcccccaggacgtgcaggtatggggaccccaggaagccaaatgactcctgtgggc
ctgaatgtgccccgtcccaaccaagtcagtgggcctgtcatgtctagtatgccacctggg
cagtggcagcaggcacccatccctcagcagcagccgatgccaggcatgcccaggcctgta
atgtccatgcaggcccaggcagcagtggctgggccacggatgcccaatgtgcagccacca
aggagcatctcgccaagtgccctgcaagacctgctacggaccctaaagtcacccagctct
cctcagcagcagcagcaggtgctgaacatccttaaatcaaacccacagctaatggcagct
ttcatcaaacagcgcacagccaagtatgtggccaatcagcctggcatgcagccccagccc
ggacttcaatcccagcctggtatgcagccccagcctggcatgcaccagcagcctagtttg
caaaacctgaacgcaatgcaagctggtgtgccacggcctggtgtgcctccaccacaacca
gcaatgggaggcctgaatccccagggacaagctctgaacatcatgaacccaggacacaac
cccaacatgacaaacatgaatccacagtaccgagaaatggtgaggagacagctgctacag
caccagcagcagcagcagcaacagcagcagcagcagcagcaacaacaaaatagtgccagc
ttggccgggggcatggcgggacacagccagttccagcagccacaaggacctggaggttat
gccccagccatgcagcagcaacgcatgcaacagcacctccccatccagggcagctccatg
ggccagatggctgctccaatgggacaacttggccagatggggcagcctgggctaggggca
gacagcacccctaatatccagcaggccctgcagcaacggattctgcagcagcagcagatg
aagcaacaaattgggtcaccaggccagccgaaccccatgagcccccagcagcacatgctc
tcaggacagccacaggcctcacatctccctggccagcagatcgccacatcccttagtaac
caggtgcgatctccagcccctgtgcagtctccacggccccaatcccaacctccacattcc
agcccgtcaccacggatacaaccccagccttcaccacaccatgtttcaccccagactggt
tcccctcaccctggactcgcagtcaccatggccagctccatggatcagggacacctgggg
aaccctgaacagagtgcaatgctcccccagctgaatacccccaacaggagcgcactgtcc
agtgaactgtccctggttggtgataccacgggagacacactagaaaagtttgtggagggt
ttgtag

KEGG   Mus musculus (mouse): 14534
Entry
14534             CDS       T01002                                 

Gene name
Kat2a, 1110051E14Rik, AW212720, Gcn, Gcn5, Gcn5l2, PCAF-B/G, mmGCN5
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    14534 (Kat2a)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    14534 (Kat2a)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    14534 (Kat2a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14534 (Kat2a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    14534 (Kat2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14534 (Kat2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     14534 (Kat2a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     14534 (Kat2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    14534 (Kat2a)
   HAT complexes
    PCAF complex
     14534 (Kat2a)
    STAGA complex
     14534 (Kat2a)
    TFTC complex
     14534 (Kat2a)
    SAGA complex
     14534 (Kat2a)
    SLIK complex
     14534 (Kat2a)
    ADA-HAT complex
     14534 (Kat2a)
    HAT-A2 complex
     14534 (Kat2a)
    ATAC complex
     14534 (Kat2a)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 T2SSM
Other DBs
NCBI-GeneID: 14534
NCBI-ProteinID: NP_064388
MGI: 1343101
Ensembl: ENSMUSG00000020918
Vega: OTTMUSG00000002053
UniProt: Q9JHD2 Q6P3Z8
Position
11 D; 11 63.53 cM
AA seq 830 aa
MAEPSQAPNPVPAAQPRPLHSPAPAPTSTPAPSPASASTPAPTPAPAPAPAAAPAGSTGS
GGAGVGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKN
PKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMS
VHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSH
LAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSC
DSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEE
EIYGANSPIWESGFTMPPSEGTQLVPRPATVSATVVPSFSPSMGGGSNSSLSLDSAGTEP
MPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARD
ETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPK
HKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSI
LYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHI
IKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKEL
KDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYY
VTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccaaacccggtcccggcagcgcagccccggccccttcac
tccccagcccctgccccaacttcgactcctgcgcccagtccggcttcagcctccactccg
gctccgactccggcaccagcccctgccccagctgcagccccagctgggagcacagggagt
gggggcgccggggtaggaagtgggggggatccggctcgacctggcctgagccagcagcag
cgcgctagccagaggaaggcgcaagtccggggtctgccgcgtgccaagaagcttgagaaa
ctaggggtcttctcagcttgcaaggccaatgaaacctgcaagtgtaatggctggaaaaac
cccaagccccccaccgcaccccgcatggacctccagcagccagctgccaacctgagcgag
ttgtgccgtagctgtgagcaccctttggcggaccatgtgtcccacctggagaatgtgtca
gaggacgagattaaccggctcttgggaatggtagtagatgtagaaaatctgttcatgtct
gttcacaaggaagaggacacagacaccaaacaagtctatttctacctcttcaagctcttg
cggaagtgcattctgcagatgacacggccagtggtggaggggtctctaggcagcccccca
tttgagaagcctaacattgaacagggtgtactgaactttgtgcagtacaaatttagccac
ctggccccccgagagcgccagacaatgtttgagctctcaaagatgttcctgctctgcctt
aactactggaagctggagacccctgctcaattccggcagcggtcccagtctgaggatgtc
gctacctacaaagtcaattataccagatggctctgttactgccacgtgccccagagctgc
gacagcctcccccgctacgagaccacccacgtgtttggccgaagccttctacggtccatt
ttcactgtcacccgccggcagctactggaaaaatttcgggtggaaaaggacaaactggtg
cctgagaagaggaccctcatcctcactcacttccccaaattcctgtccatgcttgaggaa
gagatctacggggcaaattctcccatctgggagtcaggcttcaccatgccaccttcggag
gggacacagctggtgccccggccagccacggtcagtgcaacagttgtacccagcttcagt
ccttccatgggaggaggcagcaacagctccctgagcctagattccgcagggactgagccc
atgccagcaggggagaagaggaagcttcctgagaacctgaccctggaggatgccaagcgg
ctccgcgtgatgggggacatccccatggagctggtcaatgaggtcatgctgacgatcact
gaccccgctgccatgctggggcctgagacaagcctgctttcggccaacgcagctcgagat
gagacggctcgcctggaagaacggcgaggaatcatcgagttccacgtcattggcaactcc
ctgacgcccaaggccaaccggcgcgtgctgctctggctcgtggggctgcagaatgtcttt
tcccaccagctgccaagaatgcccaaggaatatatcgcccgcctcgtctttgacccgaag
cacaagaccctggccctgatcaaggatgggcgggtcatcggtggcatttgcttccgcatg
tttcccactcagggcttcacggaaatcgtcttctgtgccgtcacctcaaatgagcaggtc
aagggctatggcacccacctgatgaaccacctaaaggagtaccacatcaaacacagcatc
ctttactttctcacctatgctgacgagtacgccattggctacttcaaaaagcagggcttc
tccaaagacatcaaggtgcccaagagccgctatctgggctacatcaaggactatgaagga
gcgacgctgatggagtgtgagctgaatccccgaatcccctacacagagctgtcccacatc
atcaagaaacagaaagagatcatcaagaagttgattgagcgcaaacaggcacagatccgc
aaggtctaccctggactcagctgcttcaaagagggagtgaggcagatcccggtggagagc
gtccctggcattcgagagacaggctggaagccactgggaaaggagaagggcaaggagctt
aaggatcctgatcagctatatacgaccctcaaaaacctgctggctcagatcaagtcacac
cccagtgcctggcccttcatggaacctgtgaagaagtcagaggctcctgactactacgag
gttatccgtttccccattgacctgaagaccatgacagaacggttgcgcagtcgctactat
gtgacccggaagctcttcgtagctgacctgcagcgggtcatcgccaactgccgggagtac
aatcccccagacagcgaatactgtcgctgcgccagtgccctggagaagttcttctacttc
aagctcaaagagggagggctcatcgacaagtag

KEGG   Mus musculus (mouse): 18519
Entry
18519             CDS       T01002                                 

Gene name
Kat2b, A930006P13Rik, AI461839, AW536563, Pc, Pcaf, p/CAF
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18519 (Kat2b)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18519 (Kat2b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    18519 (Kat2b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18519 (Kat2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    18519 (Kat2b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    18519 (Kat2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     18519 (Kat2b)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     18519 (Kat2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    18519 (Kat2b)
   HAT complexes
    PCAF complex
     18519 (Kat2b)
    STAGA complex
     18519 (Kat2b)
    TFTC complex
     18519 (Kat2b)
    SAGA complex
     18519 (Kat2b)
    SLIK complex
     18519 (Kat2b)
    ADA-HAT complex
     18519 (Kat2b)
    HAT-A2 complex
     18519 (Kat2b)
    ATAC complex
     18519 (Kat2b)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Other DBs
NCBI-GeneID: 18519
NCBI-ProteinID: NP_064389
MGI: 1343094
Ensembl: ENSMUSG00000000708
Vega: OTTMUSG00000035538
UniProt: Q9JHD1 B2RR30
Structure
PDB: 
5ML0

Position
17 C; 17 27.86 cM
AA seq 813 aa
MAEAGGAGSPALPPAPPHGSPRTLATAAGSSASCGPATAVAAAGTAEGPGGGGSARIAVK
KAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRS
CSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSI
LQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYW
HLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTI
MRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFLSASSRTSP
LGIQTVISPPVTGTALFSSNSTSHEQINGGRTSPGCRGSSGLEANPGEKRKMNNSHAPEE
AKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAARLEERRGVIEFHVV
GNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGIC
FRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKK
QGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQA
QIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPKDPEQLYSTLKNILQQV
KNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNC
KEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 2442 nt   +upstreamnt  +downstreamnt
atggccgaggctggcggggccgggtccccagcactgcctcccgcgcccccgcacggttcc
ccccggaccctggccaccgctgccgggagctctgcttcctgcgggccagcgaccgcggtg
gccgcggcgggcacggccgagggaccgggaggaggcggctcggcccggatcgccgtgaag
aaggcgcagttgcgctctgctccgcgggcgaagaagctggagaaactcggcgtgtactcc
gcctgcaaggcagaggagtcctgtaaatgcaatggctggaagaaccctaacccctctcct
actccaccaagaggagacctccagcagataattgtcagtttgacagaatcctgtcgaagc
tgtagccatgcccttgctgctcacgtttctcacttggagaatgtgtcagaggaagagatg
gacagactcctgggaattgtgttggatgtggagtacctcttcacctgcgtccacaaagaa
gaagatgcagataccaaacaagtgtacttctacctattcaagctcttgagaaagtcaatt
ttacaaagaggaaaacctgtggttgaaggctccttggagaagaagccgccatttgagaag
cccagtattgaacagggtgtgaacaacttcgtgcagtacaagtttagtcacttgccatcg
aaagagaggcagacaacgatcgagctggccaagatgtttctgaaccgcatcaactactgg
catctggaggctccatctcagcggagactacggtctcccaatgatgacatctctggatac
aaggaaaactacacaaggtggttgtgctactgcaatgtaccgcagttctgtgacagctta
cctcggtacgaaaccacaaaggtgtttgggagaacattgcttcgctcggtcttcaccatc
atgagacgacagctcttggaacaagccagacaggaaaaagacaaactgcctcttgagaaa
cgcacgcttatcctcacacatttcccaaagtttctgtccatgttggaagaagaagtgtat
agtcaaaattctcctatctgggatcaggattttctctcagcctcttccagaaccagcccg
ctaggaatccaaacagtaatcagtcctcctgttactgggacagcattgttcagttcaaat
tccacttcccatgagcagatcaatggagggagaacaagtcctggatgcagaggctcttct
gggcttgaagcaaacccgggagaaaagaggaaaatgaacaactctcatgctcccgaggag
gccaagagatctcgagtgatgggggatattcccgtggaattgatcaatgaggtcatgtct
accatcacagaccctgcagggatgcttggaccagagaccaattttctgtcagcccattcg
gccagagatgaggcggcacggctggaagaacgcaggggtgtcattgaattccacgtggtg
ggcaactccctgaaccagaaaccaaacaagaagatcctgatgtggctcgtgggcctccag
aatgtgttttcccaccagctgcccagaatgcccaaagagtacatcacacggctcgtcttt
gacccgaaacacaaaacccttgctttaattaaagatggccgtgtcattggtggtatctgt
ttccggatgtttccatcccagggattcacagagattgttttctgtgcagtaacctcaaat
gaacaagtcaagggctatggaacccacctgatgaaccatctcaaagaataccacataaag
cacgagatcctcaacttcctcacatatgcagatgagtatgccatcggctatttcaagaag
cagggtttctccaaagaaatcaaaatacctaaaaccaaatatgttggctacatcaaggat
tatgaaggggccactttgatgggatgtgagctgaaccctcagatcccatacacagagttc
tctgtcatcattaaaaagcagaaggagatcattaaaaagctgatagaaagaaaacaagcc
cagattcgaaaagtctaccctggactttcgtgtttcaaagatggagttcggcagattcct
atagaaagcattcctggaatcagagagacaggctggaaaccaagtggaaaagagaaaagt
aaagagcccaaagaccctgagcagctttacagcaccctcaagaacatcctgcagcaggtg
aagaaccatccaaatgcttggcctttcatggaaccagtgaagagaacagaagctccggga
tattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaggaac
aggtactatgtgtctaagaagttattcatggcggacttgcaacgagtgttcaccaactgc
aaggagtacaaccctcccgagagcgagtactacaaatgcgccagcatcctggagaagttc
ttcttcagtaaaattaaggaagcagggttgattgacaagtga

KEGG   Mus musculus (mouse): 328572
Entry
328572            CDS       T01002                                 

Gene name
Ep300, A430090G16, A730011L11, KAT3, KAT3B, p30, p300, p300_HAT
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04520  Adherens junction
mmu04630  JAK-STAT signaling pathway
mmu04720  Long-term potentiation
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04922  Glucagon signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
mmu05016  Huntington disease
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    328572 (Ep300)
   04330 Notch signaling pathway
    328572 (Ep300)
   04350 TGF-beta signaling pathway
    328572 (Ep300)
   04630 JAK-STAT signaling pathway
    328572 (Ep300)
   04066 HIF-1 signaling pathway
    328572 (Ep300)
   04068 FoxO signaling pathway
    328572 (Ep300)
   04024 cAMP signaling pathway
    328572 (Ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    328572 (Ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    328572 (Ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    328572 (Ep300)
   04935 Growth hormone synthesis, secretion and action
    328572 (Ep300)
   04919 Thyroid hormone signaling pathway
    328572 (Ep300)
   04916 Melanogenesis
    328572 (Ep300)
  09156 Nervous system
   04720 Long-term potentiation
    328572 (Ep300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    328572 (Ep300)
   05206 MicroRNAs in cancer
    328572 (Ep300)
   05203 Viral carcinogenesis
    328572 (Ep300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    328572 (Ep300)
   05215 Prostate cancer
    328572 (Ep300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    328572 (Ep300)
   05161 Hepatitis B
    328572 (Ep300)
   05164 Influenza A
    328572 (Ep300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    328572 (Ep300)
   05165 Human papillomavirus infection
    328572 (Ep300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    328572 (Ep300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    328572 (Ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    328572 (Ep300)
   03036 Chromosome and associated proteins [BR:mmu03036]
    328572 (Ep300)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    328572 (Ep300)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     328572 (Ep300)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    328572 (Ep300)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    328572 (Ep300)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    328572 (Ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 328572
NCBI-ProteinID: NP_808489
MGI: 1276116
Ensembl: ENSMUSG00000055024
Vega: OTTMUSG00000048223
UniProt: B2RWS6 Q8BJ14
Position
15; 15 E1
AA seq 2412 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGP
QPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGM
PSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTN
MPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSL
PAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTE
VNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKT
DGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLH
HEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPS
EGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKEL
PYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS
SLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPC
DLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRW
HCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKC
PVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQ
QPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGH
LDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQP
LPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMG
AMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQ
QQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQH
MLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADL
NSNLSQSTLDIH
NT seq 7239 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
atcagtcagcttcagacaagtcttggcatagtacaagatgcagcctcgaaacataaacag
ctgtcagaactgctgaggtctggtagctccccaaacctcaacatgggagtcggtggccca
ggccaagcgatggccagccaggcccaacagaacagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctccaaacatggggattggcagt
agtggaccaaatcagggtcctactcagtccccagcaggtatgatgaacagtccagtgaac
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaagggataatgcccaatcaagtcatgaacggttccattggagcaggc
cggggacggccaaacatgcagtacccaaatgcaggcatgggcaatgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacagccaggattgagaggcccc
caaccacttaagatgggaatgatgaacaatcccagtccttatggttcaccatacactcag
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtgggggaatg
cccagtatgggccagcagcctaccccatcggtccagcagccaggcctggtgactccagtt
gccgcaggaatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttacatgctcacaagtgccagcgccgggagcaagctaatggg
gaagtgaggcagtgcaaccttcctcactgtcgtaccatgaaaaatgtcctaaaccatatg
acacattgccagtcaggcaaatcctgccaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccagttgggcttggaaac
cctagctctctaggagtggggcagcagtccactcctagcctaagcactgttagtcagatt
gaccccagctctatagagcgagcttacgctgctcttggactaccctatcaagtaaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaagccagccatctggacagtct
ccccagggcatgcggtctgtgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gttggggttcagacgccaaatcttctttctgactccatgttgcattcaactataaattct
caaaacccaatgatgagtgaaaatgctggtgtggcctccctgggtcctttgccaacagca
gctcagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagaccgacggatggaaaatcttgttgcatatgctcgtaaagtggaaggggacatg
tatgaatctgcaaacaatagagcggaatactatcacctcctagccgagaagatctataag
atccagaaggaactagaagagaaacgaaggactagactacagaaacagaacatgctaccg
aatgctcctggcatgggtccagttcctatgaatactgggtcgaacatggggcagcaacca
acaggaatgactaccaatggtcctgtacctgacccgtctatgatccgtggcagtgtgccg
aaccacatgatgcctcggatgactccacagcctggtttgaatcaatttgggcagatgaat
atgccacagccccctattggaccccggcaaccctctcctcttcagcaccatggacaattg
gctcagtctgggtcactcaatccgcctatgggctatggacctcgcatgcagcaggcttcc
ggccagaaccagttcctctcccagactcagttcacatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcttgcccagtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
cctactctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgcacccct
actcctcatcatacccccccaagcatagggaatcaaccaccaccagcaacagcaattcca
acacctgttcctacacctcctgccataccacctggaccacagcccccatctctgcatccc
tcatctagacaaacacctacaccaccaacacatctgcctccccaagtgcagccttcactt
cctgctgctccttctgctgaccagtcccagcaacagcctcggtcacagcagagcacagca
gtttctgttcctaccccaacagcaccattgctgcctcctcagccttccactccgctttct
cagccagctgtgagcattgaaggccaggtctcaaaccctccatctactagtagcaccgaa
gtgaattctcagaccattcctgagaagcagccttcacaggaagtgaaaatggagtctaaa
atggaggtggataagccagaaccagcagatgctcaacctgaggatacaaaggaggctaaa
ggtgaggatgttaaagtagaacctacagaaatggaggagagaggccctgagttaaaaact
gatgggaaagaggaggaagaacagccaagcacctctgctacccagtcctccccagctcct
ggacagtcaaagaagaagattttcaaaccagaggaattacgacaggctctgatgccaaca
ttggaggcactttaccggcaggacccagaatctcttccctttcgtcagcctgtggacccg
cagcttctaggaatccctgattactttgatattgtgaagagccccatggatctttctaca
atcaagaggaagttagatactggacaataccaagagccctggcaatatatagatgatatt
tggcttatgttcaacaatgcctggttatataaccgtaaaacttcaagggtatacaaatat
tgctctaaactttctgaagtatttgaacaagaaattgaccctgtcatgcaaagccttgga
tactgttgtggcagaaagttggagttttctccacagactctttgttgctatgggaaacag
ttatgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaa
cctcaaactacaataaataaagaacagttttccaagagaaaaaatgacacgttggatcct
gaactgtttgttgagtgcacagagtgtggaagaaagatgcaccagatctgtgtccttcac
cacgagatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacga
actaggaaagaaaataagctttctgctaaaagattgccatctaccagacttgggaccttt
ctggagaatcgagtgaatgactttctgaggcgacaaaatcaccctgaatcaggagaggtc
actgttcgggttgttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcttttccataccgaacaaaggccctgttt
gcctttgaagaaattgatggtgttgacttgtgtttcttcggcatgcatgttcaagaatat
ggctctgactgcccccctcccaaccagaggagggtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatat
ttggaatatgtcaagaaattaggatacacaacagggcacatctgggcctgtccacccagt
gaaggggatgactatatcttccattgccatccacctgatcagaagataccaaagcccaag
cgcctgcaagaatggtacaaaaagatgcttgacaaggctgtatcagaacgtattgtccat
gactacaaggatattttaaaacaagctactgaagatcgattaacaagtgcaaaggaacta
ccctactttgaaggtgatttctggcccaatgttctagaagaaagcatcaaggagcttgaa
caggaagaggaagagaggaaacgggaagagaacaccagcaacgagagtactgatgtaaca
aaaggagacagcaaaaatgctaagaagaagaataacaagaaaaccagcaaaaacaagagc
agcctgagtaggggcaataagaagaagcctggtatgcccaatgtgtctaatgacctttct
cagaaactgtatgccaccatggaaaagcataaagaggttttctttgtgatccgcctcatc
gcttgtcctgctcccaattccctgcctcccattgttgatcctgaccctctcatcccctgt
gacctgatggacggtagagatgcatttctcacccttgcaagggacaagcacctggagttc
tcttcacttcgaagagcccagtggtctaccatgtgcatgctggtggagctccatacacag
agtcaggatcgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgctgg
cattgcactgtgtgtgaggattatgacctgtgcatcacttgttataacactaaaaatcat
gaccacaaaatggagaaactaggccttggcttagatgatgagagcaataaccagcaagct
gcagctacacagagcccaggagactcccgccgcctgagcatccaacgctgcatccagtct
ctggtgcatgcctgtcagtgccgcaacgccaactgctccctgccttcctgccagaagatg
aagagggttgtgcagcacaccaaaggctgcaaacggaaaaccaatggtgggtgccccatt
tgcaaacagcttattgccctctgctgctatcatgccaagcactgccaggagaacaagtgc
ccggtgccattttgcctcaacatcaagcaaaagctccggcagcaacagctgcagcaccgg
ctccaacaggctcagatgctccgtaggaggatggccagcatgcaacgaactggtgtggcg
gggcagcagcagggcctgccgtccccaactcctgctacaccaactacccctactggccaa
cagccagccaccccacagacaccccagccccaacccacctctcaaccacagcccactcct
cccaacaacatgacaccctacttacccaggactcagactactggccctgtgtcccagggt
aaggcaccaggccaggtgaccccacctaccccacctcagactgctcaggccccccttcca
gggcctccacctgcagcagtagaaatggcaatgcaaattcagagggcagcagagacacag
cgccagatggcccatgtacagattttccaaaggccaatccagcaccagatgccccagatg
tcacccatggcccctatgggcatgaacccacctcctatggccagaggtcctggtgggcat
ttggatccaggaataggtccagcaggaatgcagcaacagccaccttgggcccaaggagga
atgcctcagccccagcagatgcagtcagggatgccaaggccagccatgatgtcagtggcc
cagcatggtcagcctttaaacatggctccacaaccaggattgggccaagtgggtgtgagc
cctctcaagccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcagg
tctcccagttctcccttacagcagcaacaggtgcttagtatccttcatgccaacccccaa
ctgttggctgcattcatcaagcagcgggctgccaagtatgccaaccctaatccacagcct
ctccctggacagcctggcatgacccagggacagccagggctgcagccacctaccatgcct
ggccagcaaggtgtccactccaacccagccttgcagaacatgaatcctctgcaggcaggt
gtccagagagctggcctgccccagcagcagccgcagcagcagctccagccacccatggga
gcaatgagtccccaagctcagcaaatgaacatgaatcacaataccatgccttcacagttc
agagacatcttaagacggcagatgatgcaacagcagggagcagggccaggaatcggccct
ggaatggccaaccagttccagcagccccaaggaattggctatccaccgcagcagcagcag
cagcagcgaatgcagcatcacatgcagcaaatgcagcaaggaaatatgggacaaatgggt
cagcttccccaggctctgggggctgaggcaggagccagtctacaggcctatcagcagcga
cttcttcaacaacagatggggtctcctgctcagcccaaccctatgagcccacagcagcac
atgctcccaaatcaggcacagtccccacacctacaaggtcaacaaatccctaattctctc
tccaatcaagtgcgctctccccagcctgtcccttctcctcgaccacagtctcagcccccc
cattccagcccatctccgaggatgcagcctcagccttctccacaccatgtttctccacag
accagttccccacatcctggactggtagctgcccaggctgccaaccctatggaacaaggg
cattttgccagcccagaccagaattcaatgctttcacagctcgctagcaatcctggcatg
gcaaacctccacggggcaagtgccacggacctgggactgagcagcgataatgcagacttg
aattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system