KEGG   Mus musculus (mouse): 12921Help
Entry
12921             CDS       T01002                                 

Gene name
Crhr1, CRF1R, CRFR1, Crhr
Definition
(RefSeq) corticotropin releasing hormone receptor 1
  KO
K04578  corticotropin releasing hormone receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04730  Long-term depression
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12921 (Crhr1)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    12921 (Crhr1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12921 (Crhr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12921 (Crhr1)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    12921 (Crhr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 12921
NCBI-ProteinID: NP_031788
MGI: 88498
Ensembl: ENSMUSG00000018634
Vega: OTTMUSG00000003151
UniProt: P35347 Q3ZAT0
Position
11 E1; 11 67.77 cM
AA seq 415 aa AA seqDB search
MGQRPQLRLVKALLLLGLNPVSTSLQDQQCESLSLASNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgggacagcgcccgcagctccggctcgtgaaggcccttctccttctggggctgaacccc
gtctccacctccctccaggatcagcagtgtgagagcctgtccctggccagcaatgtctct
ggcctgcagtgcaatgcctccgtggacctcattggcacctgctggcccaggagccctgca
gggcagttggtggttcggccctgccctgcctttttctacggtgtccgctacaacaccaca
aacaatggctaccgggaatgcctggccaacggcagctgggcagcccgtgtgaattattct
gagtgccaggagattctcaacgaagagaagaagagcaaagtgcactaccacattgccgtc
atcatcaactacctgggccactgcatctccctggtggccctcctggtggcctttgtcctc
ttcctgcggctcaggagcatccggtgcctgaggaacatcatccactggaacctcatctcg
gctttcatcctgcgcaacgccacgtggtttgtggtccagctcaccgtgagccccgaggtc
caccagagcaacgtggcctggtgcaggctggtgacagccgcctacaactacttccacgta
accaacttcttctggatgttcggtgagggctgctacctgcacacagccatcgtactcacg
tactccaccgaccgtctgcgcaagtggatgttcgtctgcatcggctggggtgtgcctttc
cccatcattgtggcttgggccattgggaaactttactacgacaatgaaaagtgctggttt
ggcaaacgtcctggagtatatactgactacatctaccagggccccatgatcctggtcctg
ctgatcaactttatctttctcttcaacattgtccgcatcctcatgaccaaactccgagca
tccaccacatctgagactattcagtacaggaaggctgtgaaggccactctggtgctcttg
cccctcctgggcatcacctacatgttgttcttcgtcaaccctggggaggacgaggtctcc
agggttgtcttcatctacttcaactctttcctggagtcctttcagggcttcttcgtgtct
gtgttctattgttttctgaacagtgaggtccgctctgccatccggaagaggtggcggcga
tggcaggacaagcactccatcagagcccgagtggcccgcgccatgtccatccccacctcc
cccaccagagtcagcttccacagcatcaagcagtccacagcagtgtga

DBGET integrated database retrieval system