KEGG   Mus musculus (mouse): 12922Help
Entry
12922             CDS       T01002                                 

Gene name
Crhr2, CRF-R2, CRFR2alpha, CRFR2beta, Crfr2
Definition
(RefSeq) corticotropin releasing hormone receptor 2
  KO
K04579  corticotropin releasing hormone receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12922 (Crhr2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12922 (Crhr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12922 (Crhr2)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone (CRH)
    12922 (Crhr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM PAS_4
Motif
Other DBs
NCBI-GeneID: 12922
NCBI-ProteinID: NP_001275548
MGI: 894312
Ensembl: ENSMUSG00000003476
Vega: OTTMUSG00000035963
UniProt: Q60748 Q3UQP0
Structure
PDB: 

Position
6 B3; 6 27.33 cM
AA seq 411 aa AA seqDB search
MDAALLLSLLEANCSLALAEELLLDGWGVPPDPEGPYTYCNTTLDQIGTCWPQSAPGALV
ERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVN
YLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIII
AWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYC
FFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTRISFHSIKQTAAV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggcgctgctcctcagcctgctggaggccaactgcagcctggcgctggccgaa
gagctgctcctggacggctggggagtgcccccggaccccgaaggtccctacacctactgc
aacacgaccttggaccagatcgggacctgctggccacagagcgcacccggagccctagta
gagagaccgtgccccgagtacttcaatggcatcaagtacaacacgacccggaatgcctac
agagagtgcctggagaacgggacctgggcctcaagggtcaactactcacactgcgaaccc
attttggatgacaagcagagaaagtatgacctgcattaccgaatcgccctcattgtcaac
tacctgggtcactgtgtttccgtggtggccctggtggccgctttcctgcttttcctagtg
ctgcggagtatccgctgcctgaggaatgtgatccactggaacctcatcaccaccttcatt
ctgagaaacatcgcgtggttcctgctgcaactcatcgaccacgaagtgcacgagggcaat
gaggtctggtgccgctgcatcaccaccatcttcaactattttgtggtcaccaacttcttc
tggatgtttgtggagggctgctacctgcacacggccattgtcatgacgtactccacagag
cacctgcgcaagtggcttttcctcttcattggatggtgcattccctgccctatcatcatc
gcctgggcagttggcaaactctactatgagaatgagcagtgctggtttggcaaggaagct
ggtgatttggtggactacatctaccagggccccgtcatgcttgtgctgttgatcaatttt
gtatttctgtttaacatcgtcaggatcctgatgacgaagttacgagcatccaccacgtcc
gagacaatccaatacaggaaggcagtgaaggccacgctggtcctcctccccctgttgggc
atcacctacatgctcttctttgtcaatcctggcgaggacgacctgtcccagattgtgttc
atctacttcaactctttcctgcagtccttccagggtttctttgtgtccgttttctactgc
ttcttcaatggagaggtgcgcgcggccctgagaaagcggtggcaccgctggcaggaccac
cacgccctccgggtgcctgtggcccgggccatgtccatccctacgtcgcccaccaggatc
agcttccacagcatcaagcagacagctgctgtgtga

DBGET integrated database retrieval system