KEGG   Mus musculus (mouse): 12925Help
Entry
12925             CDS       T01002                                 

Gene name
Crip1, CRHP, CRP1, Crip
Definition
(RefSeq) cysteine-rich protein 1 (intestinal)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Sgf11 zf_UBZ Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 12925
NCBI-ProteinID: NP_031789
MGI: 88501
Ensembl: ENSMUSG00000006360
Vega: OTTMUSG00000052481
UniProt: P63254
Position
12 F1; 12 61.59 cM
AA seq 77 aa AA seqDB search
MPKCPKCDKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYSAM
FGPKGFGRGGAESHTFK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagtgccccaagtgcgacaaggaggtgtatttcgctgagcgagtgacttcacta
ggcaaggactggcatcgtccctgcctgaagtgtgagaaatgtggaaagacactgacctct
gggggtcatgctgagcatgaaggcaagccctactgcaatcatccctgctactccgccatg
tttgggcccaaaggctttgggcgaggtggagctgagagccacactttcaagtag

DBGET integrated database retrieval system