KEGG   Mus musculus (mouse): 12928Help
Entry
12928             CDS       T01002                                 

Gene name
Crk, Crk-I, Crk-II, Crk-III, Crk3, CrkIII, Crko, c-Crk, p38
Definition
(RefSeq) v-crk avian sarcoma virus CT10 oncogene homolog
  KO
K04438  proto-oncogene C-crk
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04510  Focal adhesion
mmu04666  Fc gamma R-mediated phagocytosis
mmu04722  Neurotrophin signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu05100  Bacterial invasion of epithelial cells
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    12928 (Crk)
   04010 MAPK signaling pathway
    12928 (Crk)
   04012 ErbB signaling pathway
    12928 (Crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12928 (Crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    12928 (Crk)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    12928 (Crk)
   04062 Chemokine signaling pathway
    12928 (Crk)
  09152 Endocrine system
   04910 Insulin signaling pathway
    12928 (Crk)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12928 (Crk)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    12928 (Crk)
   05206 MicroRNAs in cancer
    12928 (Crk)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    12928 (Crk)
   05211 Renal cell carcinoma
    12928 (Crk)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    12928 (Crk)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    12928 (Crk)
   05163 Human cytomegalovirus infection
    12928 (Crk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Motif
Other DBs
NCBI-GeneID: 12928
NCBI-ProteinID: NP_598417
MGI: 88508
Ensembl: ENSMUSG00000017776
Vega: OTTMUSG00000006211
UniProt: Q64010 Q5ND51
Structure
PDB: 

Position
11 B5; 11 45.92 cM
AA seq 304 aa AA seqDB search
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVAR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactggggccgcctgagccgg
caggaggcggtggcgctattgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgcttagcgtctccgaaaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgccctccagtgcctccgtcgcccgctcagcctccgccg
ggagtgagtccctccaggctccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtggccaga
tcaaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgggccctc
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggaaagaggggg
atgattcctgtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

DBGET integrated database retrieval system