KEGG   Mus musculus (mouse): 12934Help
Entry
12934             CDS       T01002                                 

Gene name
Dpysl2, AI851130, Crmp2, DRP2, Musunc33, TOAD-64, Ulip2
Definition
(RefSeq) dihydropyrimidinase-like 2
  KO
K07528  dihydropyrimidinase-like 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    12934 (Dpysl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 12934
NCBI-ProteinID: NP_034085
MGI: 1349763
Ensembl: ENSMUSG00000022048
Vega: OTTMUSG00000016382
UniProt: O08553
Structure
PDB: 

Position
14 D1; 14 34.6 cM
AA seq 572 aa AA seqDB search
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEA
HSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAF
DQWREWADSKSCCDYSLHVDITEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDSQ
IYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRSI
TIANQTNCPLYVTKVMSKSAAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEE
RMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRISVGSDADLVIWDPDSVKTI
SAKTHNSALEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYK
RIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFS
LSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatcaggggaagaaaaatattccacgcatcacgagcgatcgtcttctgatcaaa
ggtggcaagattgtgaatgatgaccagtccttctatgcagacatatacatggaagatggg
ttgatcaagcaaataggagaaaacctgattgtaccaggaggggtgaagaccatcgaagcc
cactccagaatggtgattcccggagggattgacgtgcatactcgcttccagatgcctgac
cagggaatgacatccgctgatgacttcttccagggaaccaaggcggccctggccggggga
accaccatgatcattgaccatgttgttcctgagcccgggacgagcctattggctgccttt
gatcagtggagggagtgggctgacagcaagtcctgctgtgactattcgctgcacgtggac
atcactgagtggcacaagggcatccaggaggagatggaagctctggtgaaggaccacggg
gtaaactccttcctcgtgtacatggctttcaaagatcgattccagctgacggattcccag
atctatgaagtgctgagcgtgatccgggatatcggtgccatagctcaagtccacgcagag
aatggtgacatcattgctgaggaacagcagaggatcctggatctgggcatcacgggcccc
gagggacacgtgttgagccggccagaggaggtcgaggctgaagctgtgaaccggtccatc
actattgccaaccagaccaactgccctctgtatgtcaccaaagtgatgagcaagagtgcg
gctgaagtcatcgctcaggcacggaagaagggaactgtggtgtatggtgagcccatcacg
gccagcctggggactgatggctctcattactggagcaagaactgggccaaggctgcggcc
tttgtcacctccccacccttgagccccgacccaaccactccagactttctcaactcgttg
ctgtcctgtggagacctccaagtcactggcagtgcccactgcaccttcaacactgcccag
aaggctgtggggaaggacaacttcaccttgattcccgagggcaccaacggcactgaggag
cggatgtctgtcatttgggataaagctgtggtcactgggaagatggatgagaatcagttt
gtggctgtgaccagcaccaacgcagccaaagtcttcaacctttacccccggaaaggtcgc
atctcggtgggatctgatgctgacttggtcatctgggaccctgacagtgtgaagaccatc
tctgccaagacacacaacagtgctcttgagtacaacatctttgaaggcatggagtgtcgc
ggctccccactggtggtcatcagccagggcaagattgtcctggaggacggcacacttcat
gtcactgaaggctcaggacgctacattccccggaagcccttccctgactttgtgtacaaa
cgcatcaaagcaaggagcaggctggctgagctgagaggggtccctcgtggcctgtatgac
ggaccggtatgcgaggtgtctgtgacgcccaagacggtgactccagcctcatcagctaag
acatcccctgccaagcagcaggcaccacctgttcggaacctgcaccagtctggattcagc
ttgtctggtgctcagattgacgacaacattccccgccgcaccacccagcgcatcgtggca
ccccctggtggccgtgccaacatcaccagcctgggctaa

DBGET integrated database retrieval system