KEGG   Mus musculus (house mouse): 12944
Entry
12944             CDS       T01002                                 
Symbol
Crp, AI255847
Name
(RefSeq) C-reactive protein, pentraxin-related
  KO
K16143  C-reactive protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    12944 (Crp)
SSDB
Motif
Pfam: Pentaxin Laminin_G_3
Other DBs
NCBI-GeneID: 12944
NCBI-ProteinID: NP_031794
MGI: 88512
Ensembl: ENSMUSG00000037942
UniProt: P14847
Position
1:172525623..172527533
AA seq 225 aa
MEKLLWCLLIMISFSRTFGHEDMFKKAFVFPKESDTSYVSLEAESKKPLNTFTVCLHFYT
ALSTVRSFSVFSYATKKNSNDILIFWNKDKQYTFGVGGAEVRFMVSEIPEAPTHICASWE
SATGIVEFWIDGKPKVRKSLHKGYTVGPDASIILGQEQDSYGGDFDAKQSLVGDIGDVNM
WDFVLSPEQISTVYVGGTLSPNVLNWRALNYKAQGDVFIKPQLWS
NT seq 678 nt   +upstreamnt  +downstreamnt
atggagaagctactctggtgccttctgatcatgatcagcttctctcggacttttggtcat
gaagacatgtttaaaaaggcctttgtatttcccaaggagtcagatacttcctatgtgtct
ctggaagcagagtcaaagaagccactgaacacctttactgtgtgtctccatttctacact
gctctgagcacagtgcgcagcttcagtgtcttctcttatgctaccaagaagaactctaac
gacattctcatattttggaataaggataaacagtatacttttggagtgggtggtgctgaa
gtacgattcatggtttcagagattcctgaggctccaacacacatctgtgccagctgggag
tctgctacggggattgtagagttctggattgatgggaaacccaaggtgcggaaaagtctg
cacaagggctacactgtggggccagatgcaagcatcatcttggggcaggagcaggactcg
tatggcggtgactttgatgcaaagcagtctttggtgggagacatcggagatgtgaacatg
tgggactttgtgctatctccagaacagatcagcacagtctatgttggtgggacactcagc
cccaatgttttgaactggcgggcactgaactataaagcacagggtgatgtgtttattaag
ccgcagctgtggtcctga

DBGET integrated database retrieval system