KEGG   Mus musculus (mouse): 12944Help
Entry
12944             CDS       T01002                                 

Gene name
Crp, AI255847
Definition
(RefSeq) C-reactive protein, pentraxin-related
  KO
K16143  C-reactive protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    12944 (Crp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pentaxin Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 12944
NCBI-ProteinID: NP_031794
MGI: 88512
Ensembl: ENSMUSG00000037942
Vega: OTTMUSG00000050157
UniProt: P14847
Position
1 H3; 1 80.13 cM
AA seq 225 aa AA seqDB search
MEKLLWCLLIMISFSRTFGHEDMFKKAFVFPKESDTSYVSLEAESKKPLNTFTVCLHFYT
ALSTVRSFSVFSYATKKNSNDILIFWNKDKQYTFGVGGAEVRFMVSEIPEAPTHICASWE
SATGIVEFWIDGKPKVRKSLHKGYTVGPDASIILGQEQDSYGGDFDAKQSLVGDIGDVNM
WDFVLSPEQISTVYVGGTLSPNVLNWRALNYKAQGDVFIKPQLWS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctactctggtgccttctgatcatgatcagcttctctcggacttttggtcat
gaagacatgtttaaaaaggcctttgtatttcccaaggagtcagatacttcctatgtgtct
ctggaagcagagtcaaagaagccactgaacacctttactgtgtgtctccatttctacact
gctctgagcacagtgcgcagcttcagtgtcttctcttatgctaccaagaagaactctaac
gacattctcatattttggaataaggataaacagtatacttttggagtgggtggtgctgaa
gtacgattcatggtttcagagattcctgaggctccaacacacatctgtgccagctgggag
tctgctacggggattgtagagttctggattgatgggaaacccaaggtgcggaaaagtctg
cacaagggctacactgtggggccagatgcaagcatcatcttggggcaggagcaggactcg
tatggcggtgactttgatgcaaagcagtctttggtgggagacatcggagatgtgaacatg
tgggactttgtgctatctccagaacagatcagcacagtctatgttggtgggacactcagc
cccaatgttttgaactggcgggcactgaactataaagcacagggtgatgtgtttattaag
ccgcagctgtggtcctga

DBGET integrated database retrieval system