KEGG   Mus musculus (mouse): 12946
Entry
12946             CDS       T01002                                 

Gene name
Cr1l, Cr, Crry, Mcp, mCR, mCRY
Definition
(RefSeq) complement component (3b/4b) receptor 1-like
  KO
K04011  complement component (3b/4b) receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05144  Malaria
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12946 (Cr1l)
   04610 Complement and coagulation cascades
    12946 (Cr1l)
   04613 Neutrophil extracellular trap formation
    12946 (Cr1l)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    12946 (Cr1l)
   05152 Tuberculosis
    12946 (Cr1l)
  09174 Infectious disease: parasitic
   05144 Malaria
    12946 (Cr1l)
   05140 Leishmaniasis
    12946 (Cr1l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12946 (Cr1l)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12946 (Cr1l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    12946 (Cr1l)
CD molecules [BR:mmu04090]
 Proteins
  12946 (Cr1l)
SSDB
Motif
Pfam: Sushi PspB MP_p6 ASFV_J13L RIFIN Cyt_c_ox_IV DUF3290 Vpu Adeno_E3_CR2
Other DBs
NCBI-GeneID: 12946
NCBI-ProteinID: NP_038527
MGI: 88513
Ensembl: ENSMUSG00000016481
Vega: OTTMUSG00000050896
UniProt: Q64735
Structure
PDB: 
1NTL

Position
1 H6; 1 98.43 cM
AA seq 440 aa
MEVSSRSSEPLDPVWLLVAFGRGGVKLEVLLLFLLPFTLGHCPAPSQLPSAKPINLTDES
MFPIGTYLLYECLPGYIKRQFSITCKQDSTWTSAEDKCIRKQCKTPSDPENGLVHVHTGI
QFGSRINYTCNQGYRLIGSSSAVCVITDQSVDWDTEAPICEWIPCEIPPGIPNGDFFSST
REDFHYGMVVTYRCNTDARGKALFNLVGEPSLYCTSNDGEIGVWSGPPPQCIELNKCTPP
PYVENAVMLSENRSLFSLRDIVEFRCHPGFIMKGASSVHCQSLNKWEPELPSCFKGVICR
LPQEMSGFQKGLGMKKEYYYGENVTLECEDGYTLEGSSQSQCQSDGSWNPLLAKCVSRSI
SGLIVGIFIGIIVFILVIIVFIWMILKYKKRNTTDEKYKEVGIHLNYKEDSCVRLQSLLT
SQENSSTTSPARNSLTQEVS
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggaggtctcttctcggagttcagagcctctggatccggtgtggctccttgtagccttc
ggccggggaggagtcaagctagaagttttgctgctgttcttgctgccatttactttgggt
cactgcccagccccatcacagcttccttctgccaaacctataaatctaactgatgaatcc
atgtttcccattggaacatatttgttgtatgaatgtctcccaggatatatcaagaggcag
ttctctatcacctgcaaacaagactcaacctggacgagtgctgaagataagtgtatacga
aaacaatgtaaaactccttcagatcctgagaatggcttggtacatgtacacacaggcatt
cagtttggatcccgtattaattatacttgtaatcaaggataccgcctcattggttcctcc
tctgctgtatgtgtcatcactgatcaaagtgttgattgggatactgaggcacctatttgt
gagtggattccttgtgagatacccccaggcattcccaatggagatttcttcagttcaacc
agagaagactttcattatggaatggtggttacctaccgctgcaacactgatgcgagaggg
aaggcgctctttaacctggtgggtgagccctccttatactgtaccagcaacgatggtgaa
attggagtctggagcggccctcctcctcagtgcattgaactcaacaaatgtactcctcct
ccctatgttgaaaatgcagtcatgctgtctgagaacagaagcttgttttccttaagggat
attgtggagtttagatgtcaccctggctttatcatgaaaggagccagcagtgtgcattgt
cagtccctaaacaaatgggagccagagttaccaagctgcttcaagggagtgatatgtcgt
ctccctcaggagatgagtggattccagaaggggttgggaatgaaaaaagaatattattat
ggagagaatgtaaccttggaatgtgaggatgggtatactctagaaggcagttctcaaagc
cagtgccagtctgatggcagctggaatcctcttctggccaaatgtgtatctcgctcaatc
agtggtctaattgttggaattttcattgggataatcgtctttattttagtcatcattgtt
ttcatttggatgattctgaagtataaaaaacgcaataccacagatgaaaagtataaagaa
gtgggtattcatttaaattataaagaagacagctgtgtccgccttcagtctctgctcaca
agtcaggagaacagcagtaccactagcccagcacggaattcactcactcaagaagtctcc
taa

DBGET integrated database retrieval system