KEGG   Mus musculus (mouse): 12952Help
Entry
12952             CDS       T01002                                 

Gene name
Cry1, AU020726, AU021000, Phll1
Definition
(RefSeq) cryptochrome 1 (photolyase-like)
  KO
K02295  cryptochrome
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    12952 (Cry1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12952 (Cry1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    12952 (Cry1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 12952
NCBI-ProteinID: NP_031797
MGI: 1270841
Ensembl: ENSMUSG00000020038
Vega: OTTMUSG00000063559
UniProt: P97784
Structure
PDB: 

Position
10 C1; 10 41.63 cM
AA seq 606 aa AA seqDB search
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMT
PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGE
NVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKV
QRQSSN
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgggggtgaacgccgtgcactggttccgaaagggactccggctccacgacaaccccgcc
ctgaaggagtgcatccagggcgccgacaccatccgctgcgtctatatcctcgacccctgg
ttcgccggctcttccaacgtgggcatcaacaggtggcgatttttgcttcagtgtcttgag
gatcttgatgccaatctacgaaaattaaattctcgtctgtttgtgattcggggacagcca
gctgatgtatttcccaggcttttcaaggaatggaacatcactaaactctcaattgagtat
gattctgagccttttgggaaggaacgagatgcagctatcaagaagctggctactgaggct
ggcgtggaagtcatcgtgcgcatttcacatacactgtatgacctggacaagatcatagaa
ctcaatggcggacagccacctctaacatataaaaggtttcagactctcgtcagcaagatg
gagccactggagatgccagcagacaccatcacatcagatgtgataggaaagtgcatgacc
cctctgtctgatgaccatgatgagaaatatggcgttccttccctggaagagctcggcttt
gatacagatggcctgtcctctgcagtgtggccaggaggagaaactgaggcacttacacgt
ttggaaaggcatttggaaagaaaggcctgggtggcaaactttgaacgacctcgaatgaat
gcaaactccctgcttgcaagcccaactggactcagtccttatctccgctttggttgttta
tcatgtcggctgttttatttcaaactaacagatctctacaaaaaggtaaagaagaatagt
tcccctcccctttctctttatgggcaactcctgtggcgtgaatttttttatacagcagcc
acaaacaacccacgctttgacaaaatggaagggaaccccatctgtgttcagatcccttgg
gacaagaaccccgaggctctggccaaatgggcagaaggccggacaggcttcccgtggatt
gacgccatcatgactcagcttcgtcaggagggctggatccaccatttagccagacacgcg
gttgcctgtttcctgactcgtggtgacctgtggatcagctgggaagaagggatgaaggtc
tttgaagagttactgcttgatgcagattggagcataaatgctggaagttggatgtggctg
tcctgcagttccttttttcagcaattttttcactgctactgccctgtgggttttggtagg
aggacagatcccaatggagactatattaggcgttatttacctgtcctaagaggcttccct
gcaaaatatatctacgatccttggaatgcaccagaaggcatccagaaggttgccaagtgt
ttgataggagttaattaccccaaaccgatggtgaaccatgctgaggcaagcagactgaat
attgaaagaatgaagcagatctatcagcagctttcccggtacagagggctaggtcttctc
gcctcggtcccttctaactctaatgggaatggagggctcatgggctatgctcctggagag
aatgtcccgagttgtagcagcagcgggaatggagggctcatgggctatgctcctggagag
aacgtcccgagctgtagcggtggaaattgctctcaaggaagtggtattttacactatgct
cacggggacagtcagcagactcactcactcaagcaagggagaagctccgcgggcaccggc
ctcagcagtgggaagcgtcctagtcaggaagaggatgcccagagtgtcggccccaaagtc
cagcggcagagcagtaactga

DBGET integrated database retrieval system