KEGG   Mus musculus (house mouse): 12953
Entry
12953             CDS       T01002                                 
Symbol
Cry2, D130054K12Rik
Name
(RefSeq) cryptochrome 2 (photolyase-like)
  KO
K02295  cryptochrome
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    12953 (Cry2)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6 ROQ_II
Other DBs
NCBI-GeneID: 12953
NCBI-ProteinID: NP_034093
MGI: 1270859
Ensembl: ENSMUSG00000068742
UniProt: Q9R194
Structure
Position
2:complement(92233991..92264426)
AA seq 592 aa
MAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFA
ASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDS
EPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMEL
PKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLD
KHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTP
PLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDA
IMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSC
SAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCII
GVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPGSSQA
GSISNTGPRALSSGPASPKRKLEAAEEPPGEELTKRARVTEMPTQEPASKDS
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggcggcggctgctgtggtggcagcgacggtccccgcgcaatcgatgggcgcggacggc
gcgtcctcggtgcactggttccgcaaaggactacggctccacgacaaccccgcgctgcta
gctgccgtgcgcggggcgcgctgtgtgcgctgcgtctacatcctcgacccgtggttcgcg
gcctcctcgtctgtgggcatcaaccgatggaggttcctactgcaatctctggaagatctg
gacacaagcttaagaaagctgaattcgcgtctgtttgtagtccggggacagccagctgat
gtgttcccaaggctgttcaaggaatggggggtgacccgtttgacctttgaatatgactct
gaaccctttgggaaagaacgggatgcagccattatgaagatggccaaggaggctggcgtg
gaggtggtgactgagaactctcacaccctctatgacctagacagaatcatcgaactgaat
gggcagaaaccaccccttacctacaagcgctttcaggccctcatcagccgcatggagctg
cccaagaagcccgcggtggctgtgagcagccagcagatggagagctgcagagctgagatc
caggagaaccatgacgacacctatggcgtgccttccctggaggagctgggattccccacg
gaaggacttggcccagctgtttggcaaggaggagagacagaagctctggcccgcctggac
aagcacttggaacggaaggcctgggttgccaactatgagagacctcggatgaatgccaat
tccttactggccagccccacaggcctcagcccctacctgcgctttggatgcctctcctgc
cgcctcttctactaccgcctgtgggacttgtacaagaaggtgaagaggaacagcacaccc
cccctctccttatttggacaactcctgtggcgagaattcttctacacagcggccaccaac
aaccccaggtttgaccgaatggaggggaaccccatctgcatccagatcccctgggaccgc
aaccccgaagccctggccaagtgggccgagggcaagacaggcttcccttggattgacgcc
atcatgacccaactgaggcaggagggctggatccaccacctggcccggcacgctgtggcc
tgcttcctcacccgcggggacctctgggtcagctgggagagcggggtccgggtatttgac
gagctgctcctggatgccgatttcagtgtgaatgcaggcagctggatgtggctgtcctgc
agtgctttcttccaacaattcttccactgctactgccctgtgggcttcggccgacgtaca
gaccccagtggggactacatccggcggtacctgcccaaactgaaaggcttcccctctcga
tacatctatgagccctggaatgcccccgagtcagttcagaaggctgccaagtgcatcatt
ggcgtggactacccacggcccatcgtcaatcatgcagagactagtcggctcaacattgaa
cgaatgaagcagatctaccaacagctgtcgagataccggggactctgtctattggcatct
gtcccttcctgtgtggaagacctcagtcaccctgtggcagagcctggttcaagccaagct
gggagcatcagcaacacaggccccagagcactatccagtggcccagcttcccccaaacgc
aagctggaagcagccgaggaacctcctggtgaagaactgaccaagcgggctagagtgacg
gagatgcctacccaagagccagcaagcaaggactcctga

DBGET integrated database retrieval system