KEGG   Mus musculus (mouse): 12954
Entry
12954             CDS       T01002                                 

Gene name
Cryaa, Acry, Acry-1, Cry, Crya, Crya-1, Crya1, DAcry, DAcry-1, lop18
Definition
(RefSeq) crystallin, alpha A
  KO
K09541  crystallin, alpha A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12954 (Cryaa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12954 (Cryaa)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   12954 (Cryaa)
SSDB
Motif
Pfam: Crystallin HSP20
Other DBs
NCBI-GeneID: 12954
NCBI-ProteinID: NP_038529
MGI: 88515
Ensembl: ENSMUSG00000024041
UniProt: P24622 Q546L9
Position
17 B1; 17 17.09 cM
AA seq 196 aa
MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISELMTHMWFVMHQPHAGNPKNNPVKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIH
GKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSER
AIPVSREEKPSSAPSS
NT seq 591 nt   +upstreamnt  +downstreamnt
atggacgtcaccattcagcatccttggttcaagcgtgccctggggcccttctaccccagc
cgactgttcgaccagttcttcggcgagggcctttttgagtacgacctgctgcccttcctg
tcttccaccatcagcccctactaccgccagtccctcttccgcactgtgctggactcgggc
atctctgagctcatgacccatatgtggtttgtaatgcaccaaccacatgctggaaacccc
aagaacaaccccgtcaaggtccgatctgaccgggacaagtttgtcatcttcttggacgtg
aagcacttctctcctgaggacctcaccgtgaaggtactggaggattttgtggagattcac
ggcaaacacaacgagaggcaggatgaccatggctacatttcccgtgaatttcaccgtcgc
taccgtctgccttccaatgtggaccagtccgccctctcctgctccctgtctgcggatggc
atgctgaccttctctggccccaaggtccagtccggtttggatgctggccacagcgagagg
gccattcctgtgtcacgggaggagaaacccagctctgcaccctcgtcctga

KEGG   Mus musculus (mouse): 12955
Entry
12955             CDS       T01002                                 

Gene name
Cryab, Cry, Crya, Crya-2, Crya2, Hsp, HspB5, P23
Definition
(RefSeq) crystallin, alpha B
  KO
K09542  crystallin, alpha B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12955 (Cryab)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    12955 (Cryab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12955 (Cryab)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12955 (Cryab)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP20
   12955 (Cryab)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12955 (Cryab)
SSDB
Motif
Pfam: Crystallin HSP20 ArsA_HSP20
Other DBs
NCBI-GeneID: 12955
NCBI-ProteinID: NP_001276711
MGI: 88516
Ensembl: ENSMUSG00000032060
Vega: OTTMUSG00000063076
UniProt: P23927 Q52L78
Position
9 A5.3; 9 27.75 cM
AA seq 175 aa
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSW
IDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR
KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK
NT seq 528 nt   +upstreamnt  +downstreamnt
atggacatcgccatccaccacccctggatccggcgccccttcttccccttccactcccca
agccgcctcttcgaccagttcttcggagagcacctgttggagtctgacctcttctcaaca
gccacttccctgagccccttctaccttcggccaccctccttcctgcgggcacccagctgg
attgacaccggactctcagagatgcgtttggagaaggacagattctctgtgaatctggac
gtgaagcacttctctccggaggaactcaaagtcaaggttctgggggacgtgattgaggtc
cacggcaagcacgaagaacgccaggacgaacatggcttcatctccagggagttccacagg
aagtaccggatcccagccgatgtggatcctctcaccatcacttcatccctgtcatctgat
ggagtcctcactgtgaatggaccaaggaaacaggtgtctggccctgagcgcaccattccc
atcacccgtgaagagaagcctgctgtcgccgcagcccctaagaagtag

DBGET integrated database retrieval system