KEGG   Mus musculus (mouse): 12977Help
Entry
12977             CDS       T01002                                 

Gene name
Csf1, C87615, Csfm, MCSF, op
Definition
(RefSeq) colony stimulating factor 1 (macrophage)
  KO
K05453  macrophage colony-stimulating factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04668  TNF signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    12977 (Csf1)
   04015 Rap1 signaling pathway
    12977 (Csf1)
   04010 MAPK signaling pathway
    12977 (Csf1)
   04668 TNF signaling pathway
    12977 (Csf1)
   04151 PI3K-Akt signaling pathway
    12977 (Csf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12977 (Csf1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12977 (Csf1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12977 (Csf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12977 (Csf1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    12977 (Csf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12977 (Csf1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12977 (Csf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSF-1
Motif
Other DBs
NCBI-GeneID: 12977
NCBI-ProteinID: NP_001107002
MGI: 1339753
Ensembl: ENSMUSG00000014599
Vega: OTTMUSG00000026573
UniProt: P07141
Structure
PDB: 

Position
3 F2.3; 3 46.83 cM
AA seq 552 aa AA seqDB search
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQME
TSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN
SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS
RDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELP
LRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHPSAGGPVPGVEDILESSLGT
NWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPRALSASPFPKSTEDQKPVDIT
DRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGSPHIATPNPQRVSNSATPVAQL
LLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSASEGAARPVARFNSIPLTDTGHVE
QHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSL
TQDEDRQVELPV
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgcggggcgctgcccttcttcgacatggctgggctcccggctg
ctgctggtctgtctcctcatgagcaggagtattgccaaggaggtgtcagaacactgtagc
cacatgattgggaatggacacctgaaggtcctgcagcagttgatcgacagtcaaatggag
acttcatgccagattgcctttgaatttgtagaccaggaacagctggatgatcctgtttgc
tacctaaagaaggccttttttctggtacaagacataatagatgagaccatgcgctttaaa
gacaacacccccaatgctaacgccaccgagaggctccaggaactctccaataacctgaac
agctgcttcaccaaggactatgaggagcagaacaaggcctgtgtccgaactttccatgag
actcctctccagctgctggagaagatcaagaacttctttaatgaaacaaagaatctcctt
gaaaaggactggaacatttttaccaagaactgcaacaacagctttgctaagtgctctagc
cgagatgtggtgaccaagcctgattgcaactgcctgtaccctaaagccacccctagcagt
gacccggcctctgcctcccctcaccagccccccgccccctccatggcccctctggctggc
ttggcttgggatgattctcagaggacagagggcagctccctcttgcccagtgagcttccc
cttcgcatagaggacccaggcagtgccaagcagcgaccacccaggagtacctgccagacc
ctcgagtcaacagagcaaccaaaccatggggacagactcactgaggactcacaacctcat
ccttctgcgggggggcccgtccctggggtggaagacattcttgaatcttcactgggcact
aactgggtcctagaagaagcttctggagaggctagtgagggatttttgacccaggaagca
aagttttccccctccacgcctgtagggggcagcatccaggcagagactgacagacccagg
gccctctcagcatctccattccctaaatcaacagaggaccaaaagccagtggatataaca
gacaggccgttgacagaggtgaaccctatgagacccattggccagacacagaataatact
cctgagaagactgatggtacatccacgctgcgtgaagaccaccaggagccaggctctccc
catattgcgacaccgaatccccaacgagtcagcaactcagccacccccgttgctcagtta
ctgcttcccaaaagccactcttggggcattgtgctgccccttggggagcttgagggcaag
agaagtaccagggatcgaaggagccccgcagagctggaaggaggatcagcaagtgagggg
gcagccaggcctgtggcccgttttaattccattcctttgactgacacaggccatgtggag
cagcatgagggatcctctgacccccagatccctgagtctgtcttccacctgctggtgccg
ggcatcatcctagtcttgctgactgttgggggcctcctgttctacaagtggaagtggagg
agccatcgagaccctcagacattggattcttctgtggggcgaccagaggacagctccctg
acccaggatgaggacagacaggtggaactgccagtatag

DBGET integrated database retrieval system