KEGG   Mus musculus (mouse): 12978Help
Entry
12978             CDS       T01002                                 

Gene name
Csf1r, AI323359, CD115, CSF-1R, Csfmr, Fim-2, Fim2, Fms, M-CSF-R, M-CSFR
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    12978 (Csf1r)
   04015 Rap1 signaling pathway
    12978 (Csf1r)
   04010 MAPK signaling pathway
    12978 (Csf1r)
   04151 PI3K-Akt signaling pathway
    12978 (Csf1r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12978 (Csf1r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12978 (Csf1r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12978 (Csf1r)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12978 (Csf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12978 (Csf1r)
   05202 Transcriptional misregulation in cancer
    12978 (Csf1r)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12978 (Csf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12978 (Csf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12978 (Csf1r)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     12978 (Csf1r)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   12978 (Csf1r)
CD molecules [BR:mmu04090]
 Proteins
  12978 (Csf1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 ig Ig_2 I-set V-set Ig_6
Motif
Other DBs
NCBI-GeneID: 12978
NCBI-ProteinID: NP_001032948
MGI: 1339758
Ensembl: ENSMUSG00000024621
Vega: OTTMUSG00000014918
UniProt: P09581 Q0P635 Q6NXV8 Q3UKC6
Structure
PDB: 

Position
18 E1; 18 34.41 cM
AA seq 977 aa AA seqDB search
MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTL
DPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEG
QEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTM
VNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRG
DTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAY
LNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRY
TFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVS
GYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMT
YFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQ
KPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAF
GLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVI
TEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDT
YVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPT
FQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCE
PGDIAQPLLQPNNYQFC
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggagttggggcctcctctggtcctgctgctggccacagtttggcatggtcagggggcc
cctgtcatcgagcctagtggcccagaactggttgtagagccgggtgaaacggtgaccctg
cgatgtgtgagcaatggcagtgtggaatgggatggccccatctctccctactggaccttg
gaccctgaatctcccggaagcaccctgaccacaagaaacgcgaccttcaaaaacactggg
acctaccgttgtaccgagcttgaagaccccatggcaggcagtaccaccatccacttgtat
gtcaaagatccggcccactcttggaatttgctggcacaggaggtgacagtggttgagggc
caggaagctgtgctgccctgtctgatcactgaccctgcactgaaggacagtgtctcactg
atgcgtgaggggggcaggcaggtcttacgcaaaacggtctacttcttctcgccatggcga
gggttcattatccgcaaggctaaagtccttgacagcaatacctacgtgtgcaagaccatg
gtgaatggtagggaatccacctccactggcatctggcttaaggtgaatcgagtccaccca
gagcccccacagataaaattggagcctagcaagctggtgcggattcgaggggaggctgcg
cagatcgtgtgctcggccactaacgccgaagtgggattcaacgttatcctcaaacgtgga
gacaccaagctggaaatccccctaaacagtgacttccaagataactattataaaaaagtc
cgggctctcagtctcaacgctgtggacttccaagacgctggcatatattcttgtgtggcc
agcaatgatgttggcacacgcacggccaccatgaacttccaggtggtggagagtgcctac
ttaaacttgacctctgagcagagcctcttgcaggaggtgtctgtgggtgacagcctcatc
ctcacggtccatgcagatgcctaccctagcatacagcattacaactggacctacctaggt
ccattctttgaagaccagcgcaagcttgagtttatcacccaaagggccatatacaggtac
acattcaagctctttctgaaccgtgtaaaggcctcagaggcgggccagtacttcttaatg
gcacaaaacaaggcaggctggaataatctgacctttgagctcaccctgcgatatccccca
gaggtcagtgttacatggatgcctgtgaatggctctgatgtcctgttctgtgacgtctct
gggtaccctcagcccagcgtgacatggatggagtgcaggggccacaccgataggtgtgat
gaagcccaggctttgcaggtttggaatgacacccaccctgaagtcctgagtcagaagccc
ttcgacaaagtgatcattcagagccagctgcccattgggaccttaaaacacaacatgact
tatttttgcaaaacccacaacagtgtgggtaacagctctcagtacttcagggccgtctcc
ctaggacaaagcaagcagctccccgatgagtccctcttcactccggtggtggtggcctgt
atgtctgtcatgtctctgctggtgctactgctgttgctgctcttgtacaagtacaagcag
aagccgaagtaccaggtgcgctggaagatcatcgagagatacgaaggcaatagctacacc
ttcattgaccctactcagttgccctacaatgagaagtgggagttccctcggaacaacctg
cagtttggtaagactctaggagccggtgcctttgggaaggtggtggaggctacagccttt
ggtctgggcaaagaagatgcagtgctgaaggtggctgtgaagatgctaaagtccacggct
catgctgatgagaaggaggccctgatgtcagagctgaagatcatgagtcacctgggacag
cacgagaatatagtcaacctcttgggagcctgtactcacggaggacctgtcctggtcatc
actgaatactgctgctatggagacctactcaactttctccgaaggaaggccgaggctatg
ctaggacccagcctgagtcctggtcaggactccgagggagactccagctacaagaacatc
cacctggagaagaaatatgtgcgcagggacagtggcttctccagtcagggtgtagacacc
tacgtggagatgaggcctgtctcgacttcttcaagtgactccttctttaagcaagatctg
gacaaagaggccagccggcccctggagctctgggacctgctccacttctccagccaagtg
gctcagggcatggccttccttgcttctaaaaactgcatccaccgggacgtagcagctcga
aacgtgctgttgaccagcggacatgtggccaagattggggactttggactggctagggac
atcatgaatgactccaactatgttgtcaagggcaatgcccgcctgcctgtaaagtggatg
gccccagagagcatctttgactgcgtctacacagttcagagtgatgtgtggtcctacggc
atcctcctctgggagatcttctcgcttggtctgaacccctaccccggcatcctagtgaac
aacaagttctacaaactggtgaaggatggataccaaatggcccagcctgtatttgcaccg
aagaacatatacagcatcatgcagtcctgctgggacctggagcctaccagaagacccacc
ttccaacagatctgcttcctcctccaggagcaggcccgactggagaggagagaccaggac
tatgctaacctgccaagcagcggtggcagcagcggcagtgacagtggtggtggcagcagc
ggtggcagcagcagtgagccagaagaggagagctccagtgaacacctggcctgctgtgag
ccaggggacatcgcccagcccctgctgcagcctaacaactaccagttctgctga

DBGET integrated database retrieval system