KEGG   Mus musculus (mouse): 12978
Entry
12978             CDS       T01002                                 

Gene name
Csf1r, AI323359, CD115, CSF-, CSF-1R, Csf, Csfmr, Fim, Fim-, Fim-2, Fim2, Fm, Fms, M-CS, M-CSF-R, M-CSFR
Definition
(RefSeq) colony stimulating factor 1 receptor
  KO
K05090  macrophage colony-stimulating factor 1 receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12978 (Csf1r)
   04014 Ras signaling pathway
    12978 (Csf1r)
   04015 Rap1 signaling pathway
    12978 (Csf1r)
   04151 PI3K-Akt signaling pathway
    12978 (Csf1r)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12978 (Csf1r)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12978 (Csf1r)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12978 (Csf1r)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12978 (Csf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12978 (Csf1r)
   05202 Transcriptional misregulation in cancer
    12978 (Csf1r)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12978 (Csf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12978 (Csf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12978 (Csf1r)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     12978 (Csf1r)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   12978 (Csf1r)
CD molecules [BR:mmu04090]
 Proteins
  12978 (Csf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig Ig_2 I-set V-set Ig_6 AF-4
Other DBs
NCBI-GeneID: 12978
NCBI-ProteinID: NP_001032948
MGI: 1339758
Ensembl: ENSMUSG00000024621
Vega: OTTMUSG00000014918
UniProt: P09581 Q6NXV8 Q3UKC6 Q0P635
Structure
PDB: 
3EJJ 4EXP

Position
18 E1; 18 34.41 cM
AA seq 977 aa
MELGPPLVLLLATVWHGQGAPVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTL
DPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEG
QEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTM
VNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRG
DTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAY
LNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRY
TFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVS
GYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMT
YFCKTHNSVGNSSQYFRAVSLGQSKQLPDESLFTPVVVACMSVMSLLVLLLLLLLYKYKQ
KPKYQVRWKIIERYEGNSYTFIDPTQLPYNEKWEFPRNNLQFGKTLGAGAFGKVVEATAF
GLGKEDAVLKVAVKMLKSTAHADEKEALMSELKIMSHLGQHENIVNLLGACTHGGPVLVI
TEYCCYGDLLNFLRRKAEAMLGPSLSPGQDSEGDSSYKNIHLEKKYVRRDSGFSSQGVDT
YVEMRPVSTSSSDSFFKQDLDKEASRPLELWDLLHFSSQVAQGMAFLASKNCIHRDVAAR
NVLLTSGHVAKIGDFGLARDIMNDSNYVVKGNARLPVKWMAPESIFDCVYTVQSDVWSYG
ILLWEIFSLGLNPYPGILVNNKFYKLVKDGYQMAQPVFAPKNIYSIMQSCWDLEPTRRPT
FQQICFLLQEQARLERRDQDYANLPSSGGSSGSDSGGGSSGGSSSEPEEESSSEHLACCE
PGDIAQPLLQPNNYQFC
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggagttggggcctcctctggtcctgctgctggccacagtttggcatggtcagggggcc
cctgtcatcgagcctagtggcccagaactggttgtagagccgggtgaaacggtgaccctg
cgatgtgtgagcaatggcagtgtggaatgggatggccccatctctccctactggaccttg
gaccctgaatctcccggaagcaccctgaccacaagaaacgcgaccttcaaaaacactggg
acctaccgttgtaccgagcttgaagaccccatggcaggcagtaccaccatccacttgtat
gtcaaagatccggcccactcttggaatttgctggcacaggaggtgacagtggttgagggc
caggaagctgtgctgccctgtctgatcactgaccctgcactgaaggacagtgtctcactg
atgcgtgaggggggcaggcaggtcttacgcaaaacggtctacttcttctcgccatggcga
gggttcattatccgcaaggctaaagtccttgacagcaatacctacgtgtgcaagaccatg
gtgaatggtagggaatccacctccactggcatctggcttaaggtgaatcgagtccaccca
gagcccccacagataaaattggagcctagcaagctggtgcggattcgaggggaggctgcg
cagatcgtgtgctcggccactaacgccgaagtgggattcaacgttatcctcaaacgtgga
gacaccaagctggaaatccccctaaacagtgacttccaagataactattataaaaaagtc
cgggctctcagtctcaacgctgtggacttccaagacgctggcatatattcttgtgtggcc
agcaatgatgttggcacacgcacggccaccatgaacttccaggtggtggagagtgcctac
ttaaacttgacctctgagcagagcctcttgcaggaggtgtctgtgggtgacagcctcatc
ctcacggtccatgcagatgcctaccctagcatacagcattacaactggacctacctaggt
ccattctttgaagaccagcgcaagcttgagtttatcacccaaagggccatatacaggtac
acattcaagctctttctgaaccgtgtaaaggcctcagaggcgggccagtacttcttaatg
gcacaaaacaaggcaggctggaataatctgacctttgagctcaccctgcgatatccccca
gaggtcagtgttacatggatgcctgtgaatggctctgatgtcctgttctgtgacgtctct
gggtaccctcagcccagcgtgacatggatggagtgcaggggccacaccgataggtgtgat
gaagcccaggctttgcaggtttggaatgacacccaccctgaagtcctgagtcagaagccc
ttcgacaaagtgatcattcagagccagctgcccattgggaccttaaaacacaacatgact
tatttttgcaaaacccacaacagtgtgggtaacagctctcagtacttcagggccgtctcc
ctaggacaaagcaagcagctccccgatgagtccctcttcactccggtggtggtggcctgt
atgtctgtcatgtctctgctggtgctactgctgttgctgctcttgtacaagtacaagcag
aagccgaagtaccaggtgcgctggaagatcatcgagagatacgaaggcaatagctacacc
ttcattgaccctactcagttgccctacaatgagaagtgggagttccctcggaacaacctg
cagtttggtaagactctaggagccggtgcctttgggaaggtggtggaggctacagccttt
ggtctgggcaaagaagatgcagtgctgaaggtggctgtgaagatgctaaagtccacggct
catgctgatgagaaggaggccctgatgtcagagctgaagatcatgagtcacctgggacag
cacgagaatatagtcaacctcttgggagcctgtactcacggaggacctgtcctggtcatc
actgaatactgctgctatggagacctactcaactttctccgaaggaaggccgaggctatg
ctaggacccagcctgagtcctggtcaggactccgagggagactccagctacaagaacatc
cacctggagaagaaatatgtgcgcagggacagtggcttctccagtcagggtgtagacacc
tacgtggagatgaggcctgtctcgacttcttcaagtgactccttctttaagcaagatctg
gacaaagaggccagccggcccctggagctctgggacctgctccacttctccagccaagtg
gctcagggcatggccttccttgcttctaaaaactgcatccaccgggacgtagcagctcga
aacgtgctgttgaccagcggacatgtggccaagattggggactttggactggctagggac
atcatgaatgactccaactatgttgtcaagggcaatgcccgcctgcctgtaaagtggatg
gccccagagagcatctttgactgcgtctacacagttcagagtgatgtgtggtcctacggc
atcctcctctgggagatcttctcgcttggtctgaacccctaccccggcatcctagtgaac
aacaagttctacaaactggtgaaggatggataccaaatggcccagcctgtatttgcaccg
aagaacatatacagcatcatgcagtcctgctgggacctggagcctaccagaagacccacc
ttccaacagatctgcttcctcctccaggagcaggcccgactggagaggagagaccaggac
tatgctaacctgccaagcagcggtggcagcagcggcagtgacagtggtggtggcagcagc
ggtggcagcagcagtgagccagaagaggagagctccagtgaacacctggcctgctgtgag
ccaggggacatcgcccagcccctgctgcagcctaacaactaccagttctgctga

KEGG   Mus musculus (mouse): 13649
Entry
13649             CDS       T01002                                 

Gene name
Egfr, 9030024J15Rik, AI552599, Erb, Erbb, Err, Errb1, Errp, Wa, Wa5, wa-2, wa2
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13649 (Egfr)
   04012 ErbB signaling pathway
    13649 (Egfr)
   04014 Ras signaling pathway
    13649 (Egfr)
   04015 Rap1 signaling pathway
    13649 (Egfr)
   04630 JAK-STAT signaling pathway
    13649 (Egfr)
   04066 HIF-1 signaling pathway
    13649 (Egfr)
   04068 FoxO signaling pathway
    13649 (Egfr)
   04020 Calcium signaling pathway
    13649 (Egfr)
   04072 Phospholipase D signaling pathway
    13649 (Egfr)
   04151 PI3K-Akt signaling pathway
    13649 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    13649 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13649 (Egfr)
   04520 Adherens junction
    13649 (Egfr)
   04540 Gap junction
    13649 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13649 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    13649 (Egfr)
   04915 Estrogen signaling pathway
    13649 (Egfr)
   04921 Oxytocin signaling pathway
    13649 (Egfr)
   04926 Relaxin signaling pathway
    13649 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    13649 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13649 (Egfr)
   05206 MicroRNAs in cancer
    13649 (Egfr)
   05205 Proteoglycans in cancer
    13649 (Egfr)
   05230 Central carbon metabolism in cancer
    13649 (Egfr)
   05231 Choline metabolism in cancer
    13649 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13649 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13649 (Egfr)
   05212 Pancreatic cancer
    13649 (Egfr)
   05225 Hepatocellular carcinoma
    13649 (Egfr)
   05226 Gastric cancer
    13649 (Egfr)
   05214 Glioma
    13649 (Egfr)
   05218 Melanoma
    13649 (Egfr)
   05219 Bladder cancer
    13649 (Egfr)
   05215 Prostate cancer
    13649 (Egfr)
   05213 Endometrial cancer
    13649 (Egfr)
   05224 Breast cancer
    13649 (Egfr)
   05223 Non-small cell lung cancer
    13649 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13649 (Egfr)
   05171 Coronavirus disease - COVID-19
    13649 (Egfr)
   05163 Human cytomegalovirus infection
    13649 (Egfr)
   05165 Human papillomavirus infection
    13649 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    13649 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13649 (Egfr)
   01522 Endocrine resistance
    13649 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13649 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13649 (Egfr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13649 (Egfr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13649 (Egfr)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   13649 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   13649 (Egfr)
  Exosomal proteins of bladder cancer cells
   13649 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 13649
NCBI-ProteinID: NP_997538
MGI: 95294
Ensembl: ENSMUSG00000020122
Vega: OTTMUSG00000005185
UniProt: Q01279 Q9EP98 Q9WVF5 Q3TQS6
Position
11 A2; 11 9.41 cM
AA seq 1210 aa
MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
ILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDL
QSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIM
GENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIV
VVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVL
GSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLL
GICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDL
AARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVW
SYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSR
PKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLI
PQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTED
NIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLN
TAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRV
APPSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggaccgcgagaaccacactgctggtgttgctgaccgcgctctgcgcc
gcaggtggggcgttggaggaaaagaaagtctgccaaggcacaagtaacaggctcacccaa
ctgggcacttttgaagaccactttctgagcctgcagaggatgtacaacaactgtgaagtg
gtccttgggaacttggaaattacctatgtgcaaaggaattacgacctttccttcttaaag
accatccaggaggtggccggctatgtcctcattgccctcaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctttatgaaaacacctatgccttagcc
atcctgtccaactatgggacaaacagaactgggcttagggaactgcccatgcggaactta
caggaaatcctgattggtgctgtgcgattcagcaacaaccccatcctctgcaatatggat
actatccagtggagggacatcgtccaaaacgtctttatgagcaacatgtcaatggactta
cagagccatccgagcagttgccccaaatgtgatccaagctgtcccaatggaagctgctgg
ggaggaggagaggagaactgccagaaattgaccaaaatcatctgtgcccagcaatgttcc
catcgctgtcgtggcaggtcccccagtgactgctgccacaaccaatgtgctgcggggtgt
acagggccccgagagagtgactgtctggtctgccaaaagttccaagatgaggccacatgc
aaagacacctgcccaccactcatgctgtacaaccccaccacctatcagatggatgtcaac
cctgaagggaagtacagctttggtgccacctgtgtgaagaagtgcccccgaaactacgtg
gtgacagatcatggctcatgtgtccgagcctgtgggcctgactactacgaagtggaagaa
gatggcatccgcaagtgtaaaaaatgtgatgggccctgtcgcaaagtttgtaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaaa
tactgcactgccatcagcggggaccttcacatcctgccagtggcctttaagggggattct
ttcacgcgcactcctcctctagacccacgagaactagaaattctaaaaaccgtaaaggaa
ataacaggctttttgctgattcaggcttggcctgataactggactgacctccatgctttc
gagaacctagaaataatacgtggcagaacaaagcaacatggtcagttttctttggcggtc
gttggcctgaacatcacatcactggggctgcgttccctcaaggagatcagtgatggggat
gtgatcatttctggaaaccgaaatttgtgctacgcaaacacaataaactggaaaaaactc
ttcgggacacccaatcagaaaaccaaaatcatgaacaacagagctgagaaagactgcaag
gccgtgaaccacgtctgcaatcctttatgctcctcggaaggctgctggggccctgagccc
agggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggagaaatgcaac
atcctggagggggaaccaagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccaggccatgaacatcacctgtacaggcaggggaccagacaactgcatc
cagtgtgcccactacattgatggcccacactgtgtcaagacctgcccagctggcatcatg
ggagagaacaacactctggtctggaagtatgcagatgccaataatgtctgccacctatgc
cacgccaactgtacctatggatgtgctgggccaggtcttcaaggatgtgaagtgtggcca
tctgggccaaagataccatctattgccactgggattgtgggtggcctcctcttcatagtg
gtggtggcccttgggattggcctattcatgcgaagacgtcacattgttcgaaagcgtaca
ctacgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagct
ccaaaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctg
ggttcgggagcatttggcacagtgtataagggtctctggatcccagaaggtgagaaagta
aaaatcccggtggccatcaaggagttaagagaagccacatctccaaaagccaacaaagaa
atccttgacgaagcctatgtgatggctagtgtggacaaccctcatgtatgccgcctcctg
ggcatctgtctgacctccactgtccagctcattacacagctcatgccctacggttgcctc
ctggactacgtccgagaacacaaggacaacattggctcccagtacctcctcaactggtgt
gtgcagattgcaaagggcatgaactacctggaagatcggcgtttggtgcaccgtgacttg
gcagccaggaatgtactggtgaagacaccacagcatgtcaagatcacagattttgggctg
gccaaactgcttggtgctgaagagaaagaatatcatgccgaggggggcaaagtgcctatc
aagtggatggctttggaatcaattttacaccgaatttatacacaccaaagtgatgtctgg
agctatggtgtcactgtgtgggaactgatgacctttgggtccaagccttatgatggaatc
ccagcaagtgacatctcatccatcctagagaaaggagagcgccttccacagccacctatc
tgcaccatcgatgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgc
ccaaagttccgagagttgattcttgaattctccaaaatggcccgagacccacagcgctac
cttgttatccagggggatgaaagaatgcatttgccaagccctacagactccaacttttac
cgagccctgatggatgaagaggacatggaggatgtagttgatgctgatgagtatcttatc
ccacagcaaggcttcttcaacagcccgtccacgtcgaggactcccctcttgagttctctg
agtgcaactagcaacaattccactgtggcttgcattaatagaaatgggagctgccgtgtc
aaagaagacgccttcttgcagcggtacagctccgaccccacaggtgctgtaacagaggac
aacatagatgacgcattcctccctgtacctgaatatgtaaaccaatctgttcccaagagg
ccagcaggctctgtgcagaaccctgtctatcacaatcagcccctgcatccagctcctgga
agagacctgcattatcaaaatccccacagcaatgcagtgggcaaccctgagtatctcaac
actgcccagcctacctgtctcagtagtgggtttaacagccctgcactctggatccagaaa
ggcagtcaccaaatgagcctagacaaccctgactaccagcaggacttcttccccaaggaa
accaagccaaatggcatatttaagggccccacagctgaaaatgcagagtacctacgggtg
gcacctccaagcagtgagtttattggagcatga

KEGG   Mus musculus (mouse): 13836
Entry
13836             CDS       T01002                                 

Gene name
Epha2, AW545284, Eck, Myk2, Sek, Sek-, Sek-2, Sek2
Definition
(RefSeq) Eph receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13836 (Epha2)
   04014 Ras signaling pathway
    13836 (Epha2)
   04015 Rap1 signaling pathway
    13836 (Epha2)
   04151 PI3K-Akt signaling pathway
    13836 (Epha2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13836 (Epha2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13836 (Epha2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13836 (Epha2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13836 (Epha2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Pur_ac_phosph_N Interfer-bind DUF2369 Ephrin_rec_like SAM_KSR1 SKG6
Other DBs
NCBI-GeneID: 13836
NCBI-ProteinID: NP_034269
MGI: 95278
Ensembl: ENSMUSG00000006445
Vega: OTTMUSG00000010200
UniProt: Q03145
Structure
PDB: 
5ZRX

Position
4 D3; 4 73.67 cM
AA seq 977 aa
MELRAVGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDD
MPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNL
YYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLA
FQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYG
GEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLP
STEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQD
IVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVS
GLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDA
NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSANMAVIG
GVAVGVVLLLVLAGVGLFIHRRRRNLRARQSSEDVRFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCVARQKVIGAGEFGEVYKGTLKASSGKKEIPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGM
LRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNEDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggagctccgggcagtcggtttctgcctggcgctgctgtggggttgcgcgctggcggcc
gcggcggcacagggaaaggaagttgttttgttggacttcgcagcaatgaagggagagctc
ggctggctcacgcacccctatggcaaagggtgggacctgatgcagaacatcatggacgac
atgcctatctacatgtactcggtgtgcaacgtggtatccggcgaccaggacaactggctc
cgcaccaactgggtgtaccgggaggaggccgagcgcatctttattgagctcaagttcacg
gtgcgagactgtaacagcttcccgggtggcgccagctcatgcaaagagaccttcaacctc
tactatgcagagtcagatgtggactatggcaccaacttccagaagcgccagttcaccaag
attgacaccatcgcccctgacgagatcacggtcagcagtgacttcgaggctcgcaatgtc
aagctgaacgtagaggagcgcatggtggggccccttacccggaagggcttctacctggcc
ttccaggacatcggcgcctgcgtggcgctgctctccgttcgcgtctactacaagaagtgt
cccgagatgctgcagagcttggctcgcttccccgagaccattgctgtcgctgtctccgat
acacaacccctggccacggtggccggtacctgcgtggaccatgccgtggtgccttatggg
ggcgaggggcctctcatgcactgcacggtggatggcgagtggctggtgcccatcgggcag
tgcctgtgccaggaaggctacgagaaggtcgaggatgcctgccgagcctgttctccagga
ttcttcaagtctgaggcatctgagagcccttgcctggagtgtccagagcataccctgcca
tccacagagggtgccacctcctgccagtgtgaagaaggctatttcagggcacctgaggac
ccactgtccatgtcttgcacacgtccaccctctgcccccaactacctcacggccattggc
atgggtgccaaagtagaactgcgttggacagctcccaaggacactggtggccgccaggac
attgtctacagtgtcacttgcgaacagtgctggccagagtctggcgagtgtgggccctgt
gaggcgagcgtgcgctattcagaacctcctcacgccctgacccgcacgagtgtgacagtc
agtgacctggagccccacatgaactataccttcgctgtcgaagcacgcaatggtgtctca
ggcctggtgactagccgaagcttccggactgccagcgtcagtattaaccaaacagagccc
cccaaagtgaggctggaggaccgaagcaccacctccctgagtgtcacctggagcatcccg
gtgtcacagcagagccgtgtgtggaagtacgaagtcacctaccgcaagaagggggatgcc
aacagctataatgtgcgccgcacggaaggcttctccgtgaccctggatgaccttgctccg
gataccacgtacctggtgcaggtgcaggcgctgacgcaggagggccagggagccggcagc
aaagtgcacgagttccagacactgtccacggaaggatctgccaacatggcggtgatcggc
ggtgtggctgtaggtgttgttttgcttctggtactggcaggagttggcctcttcatccat
cgaaggaggaggaacctgcgggctcgccagtcctctgaggatgtccgtttttccaagtca
gaacaactaaagcccctgaagacctatgtggatcctcacacttacgaagaccccaaccag
gctgtactcaagtttaccaccgagatccacccatcctgtgtggcaaggcagaaggtcatt
ggagcaggagagtttggagaggtctataaagggacgctgaaggcatcctcggggaagaag
gagataccggtggccatcaagacactgaaagcgggctacactgagaagcagcgggtggac
ttcctgagcgaggccagcatcatgggccagtttagccaccacaatatcatccgcctggag
ggcgtggtctctaaatacaaacccatgatgattatcacagagtacatggagaatggagcg
ctagacaagttccttagggagaaggatggtgagttcagtgtacttcagttggtgggcatg
ctgaggggtatcgcatccggcatgaagtacctggccaacatgaactacgtgcaccgggac
ctggccgcccgcaacatcctcgtcaacagcaacctggtgtgcaaggtgtccgattttggc
ctgtcgcgtgtgctggaagatgaccccgaggccacctacaccacaagtggcggcaagatc
cctattcgatggacagccccagaggccatttcctaccgcaagttcacctcagccagcgat
gtgtggagctacggcattgtcatgtgggaagtgatgacttatggcgaacggccctactgg
gaactgtcaaaccacgaggtcatgaaagccatcaacgacggcttccggctccctacgccc
atggactgcccttcagccatttaccagctcatgatgcagtgctggcagcaagagcgctcc
cgccgacccaagtttgccgacatcgttagcatcctggacaagctcatccgagcccccgac
tccctcaagacgctggctgactttgatccccgagtgtccatccggctgcccagcaccagc
ggctcggagggagtccccttccgtacggtgtccgagtggctggagagcatcaagatgcaa
cagtacacggaacacttcatggtggctggctacacggccatcgagaaggtggtacagatg
tccaacgaagacatcaaaaggatcggagtgcgtcttcctggccaccagaagcgtattgcc
tacagcctgctgggactcaaggaccaggtcaacacagtggggattcctatctga

KEGG   Mus musculus (mouse): 13866
Entry
13866             CDS       T01002                                 

Gene name
Erbb2, ErbB-, Erbb-2, HER, HER-, HER-2, HER2, Ne, Neu, c-erbB, c-erbB2, c-ne, c-neu, l11Ju, l11Jus8, mKIAA3023
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04530  Tight junction
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13866 (Erbb2)
   04012 ErbB signaling pathway
    13866 (Erbb2)
   04066 HIF-1 signaling pathway
    13866 (Erbb2)
   04020 Calcium signaling pathway
    13866 (Erbb2)
   04151 PI3K-Akt signaling pathway
    13866 (Erbb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13866 (Erbb2)
   04520 Adherens junction
    13866 (Erbb2)
   04530 Tight junction
    13866 (Erbb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13866 (Erbb2)
   05206 MicroRNAs in cancer
    13866 (Erbb2)
   05205 Proteoglycans in cancer
    13866 (Erbb2)
   05230 Central carbon metabolism in cancer
    13866 (Erbb2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    13866 (Erbb2)
   05226 Gastric cancer
    13866 (Erbb2)
   05219 Bladder cancer
    13866 (Erbb2)
   05215 Prostate cancer
    13866 (Erbb2)
   05213 Endometrial cancer
    13866 (Erbb2)
   05224 Breast cancer
    13866 (Erbb2)
   05223 Non-small cell lung cancer
    13866 (Erbb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13866 (Erbb2)
   01524 Platinum drug resistance
    13866 (Erbb2)
   01522 Endocrine resistance
    13866 (Erbb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13866 (Erbb2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    13866 (Erbb2)
   04090 CD molecules [BR:mmu04090]
    13866 (Erbb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13866 (Erbb2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13866 (Erbb2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   13866 (Erbb2)
CD molecules [BR:mmu04090]
 Proteins
  13866 (Erbb2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH DUF5849 Kinase-like EphA2_TM
Other DBs
NCBI-GeneID: 13866
NCBI-ProteinID: NP_001003817
MGI: 95410
Ensembl: ENSMUSG00000062312
Vega: OTTMUSG00000002711
UniProt: P70424
Position
11 61.75 cM; 11 D
AA seq 1256 aa
MELAAWCRWGFLLALLSPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQDIQEVQGYMLIAHNRVKHVPLQRLRIVRGTQLFEDKYALAVLDNR
DPLDNVTTAAPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVLRKNNQL
APVDMDTNRSRACPPCAPTCKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQ
CAAGCTGPKHSDCLACLHFNHSGICELHCPALITYNTDTFESMLNPEGRYTFGASCVTTC
PYNYLSTEVGSCTLVCPPNNQEVTAEDGTQRCEKCSKPCAGVCYGLGMEHLRGARAITSD
NIQEFAGCKKIFGSLAFLPESFDGNPSSGVAPLKPEHLQVFETLEEITGYLYISAWPESF
QDLSVFQNLRVIRGRILHDGAYSLTLQGLGIHSLGLRSLRELGSGLALIHRNTHLCFVNT
VPWDQLFRNPHQALLHSGNRPEEACGLEGLVCNSLCARGHCWGPGPTQCVNCSQFLRGQE
CVEECRVWKGLPREYVRGKHCLPCHPECQPQNSSETCYGSEADQCEACAHYKDSSSCVAR
CPSGVKPDLSYMPIWKYPDEEGICQPCPINCTHSCVDLDERGCPAEQRASPVTFIIATVV
GVLLFLIIVVVIGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAVPNQAQMRILKETE
LRKLKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGS
PYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEEV
RLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRF
THQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCW
MIDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPSSPMDSTFYRSLLEDDDMGELVD
AEEYLVPQQGFFSPDPALGTGSTAHRRHRSSSARSGGGELTLGLEPSEEEPPRSPLAPSE
GAGSDVFDGDLAVGVTKGLQSLSPHDLSPLQRYSEDPTLPLPPETDGYVAPLACSPQPEY
VNQPEVRPQSPLTPEGPPPPIRPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAP
RAGTASQPHPSPAFSPAFDNLYYWDQNSSEQGPPPSTFEGTPTAENPEYLGLDVPV
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgttgggggttcctcctcgccctcctgtcccccggagcc
gcgggtacccaagtgtgtaccggtaccgacatgaagttgcgactccctgccagtcctgag
acccacctggacatgcttcgccacctctaccagggctgtcaggtggtgcagggcaatttg
gagcttacctacctgcccgccaatgccagcctctcattcctgcaggacatccaggaagtc
cagggatacatgctcatcgctcacaaccgagtgaaacacgtcccactgcagaggttgcgc
atcgtgagagggactcagctctttgaggacaagtatgccctggctgtgctagacaaccga
gaccctttggacaacgtcaccaccgccgccccaggcagaaccccagaagggctgcgggag
ctgcagcttcgaagtctcacagagatcttgaagggaggagttttgatccgtgggaaccct
cagctctgctaccaggacatggttttgtggaaggatgtcctccgtaagaataaccagctg
gctcctgtcgacatggacaccaatcgttcccgggcctgtccaccttgtgccccaacctgc
aaagacaatcactgttggggtgagagtcctgaagactgtcagatcttgactggcaccatc
tgtactagtggctgtgcccggtgcaagggccggctgcccactgactgttgccatgagcag
tgtgctgcaggctgcacgggtcccaagcattctgactgcctggcctgcctccacttcaat
catagtggtatctgtgagctgcactgcccggccctcatcacctacaacacagacaccttc
gagtccatgctcaaccctgagggtcgctacacctttggtgccagctgtgtgaccacctgc
ccctacaactacctctccacggaagtgggatcctgcactctggtctgtcccccgaacaac
caagaggtcacagctgaggacggaacacagcggtgtgagaaatgcagcaagccctgtgct
ggagtatgctatggtctgggcatggagcacctccgaggggcgagggccatcaccagtgac
aatatccaggagtttgctggctgcaagaagatctttgggagcctggcatttttgccggag
agctttgatgggaacccctcctccggcgttgccccactgaagccagagcatctccaagtg
ttcgaaaccctggaggagatcacaggttacctatacatttcagcatggccagagagcttc
caagacctcagtgtcttccagaaccttcgggtcattcggggacggattctccatgatggt
gcttactcattgacgttgcaaggcctggggattcactcactggggctacgctcactgcgg
gagctgggcagtggattggctctcattcaccgcaacacccatctctgctttgtaaacact
gtaccttgggaccagctcttccggaacccgcaccaggccctactccacagtgggaaccgg
ccagaagaggcatgtggtcttgagggcttggtctgtaactcactgtgtgcccgtgggcac
tgctgggggccagggcccacccagtgtgtcaactgcagtcagttcctccggggccaggag
tgtgtggaggagtgccgagtatggaaggggctccccagggagtatgtgaggggcaagcac
tgtctgccatgccaccccgagtgtcagcctcaaaacagctcggagacctgctatggatcg
gaggctgaccagtgtgaggcttgtgcccactacaaggactcatcttcctgtgtggctcgc
tgccccagtggtgtgaagccagacctctcctacatgcctatctggaagtacccggatgag
gagggcatatgtcagccatgccccatcaactgcacccactcatgtgtggacctggacgaa
cgaggctgcccagcagagcagagagccagcccagtgacattcatcattgcaactgtggtg
ggcgtcctgttgttcctgatcatagtggtggtcattggaatcctaatcaaacgaaggcga
cagaagatccggaagtataccatgcgtaggctgctgcaggagaccgagctggtggagccg
ctgacgcccagtggagctgtgcccaaccaggctcagatgcggatcctaaaggagacagag
ctaaggaagctgaaggtgcttgggtcaggagccttcggcactgtctacaagggcatctgg
atcccagatggggagaacgtgaaaatccccgtggccatcaaggtgttgagggaaaacaca
tctcctaaagctaacaaagaaatcctagatgaagcgtacgtcatggctggtgtgggttct
ccatatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtgacacag
cttatgccctatggctgccttctggaccatgtccgagaacaccgaggtcgcttaggctcc
caggacctgctcaactggtgtgttcagattgccaaggggatgagctacctggaggaagtt
cggcttgttcacagggacctagctgcccgaaacgtgctagtcaagagtcccaaccacgtc
aagattaccgacttcgggctggcacggctgctggacattgatgagactgaataccatgca
gatgggggcaaggtgcccatcaagtggatggcattggaatctattctcagacgccggttc
acccatcagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacctttggg
gccaaaccttacgatgggatcccagctcgggagatccctgatttgctggagaagggagaa
cgcctacctcagcctccaatctgcaccatcgacgtctacatgatcatggtcaaatgttgg
atgattgactccgaatgtcgcccgagattccgggagttggtatcagaattctcccgtatg
gcaagggacccccagcgctttgtggtcatccagaacgaggacttaggcccctccagcccc
atggacagcaccttctaccgttcactgctggaggatgatgacatgggggagctggtcgat
gctgaagagtacctggtaccccagcagggattcttctccccagaccctgccctaggtact
gggagcacagcccaccgcagacaccgcagctcgtcggccaggagtggcggtggtgagctg
acactgggcctggagccctcggaagaagagccccccagatctccactggctccctccgaa
ggggctggctccgatgtgtttgatggtgacctggcagtgggggtaaccaaaggactgcag
agcctctctccacatgacctcagccctctacagcggtacagtgaggatcccacattacct
ctgccccccgagactgatggctacgttgctcccctggcctgcagcccccagcccgagtat
gtgaaccagccagaggttcggcctcagtctcccttgaccccagagggtcctccgcctccc
atccgacctgctggtgctactctagaaagacccaagactctctctcctgggaaaaatggg
gttgtcaaagacgtttttgcctttgggggtgctgtggagaaccctgaatacttagcaccc
agagcaggcactgcctctcagccccacccttctcctgccttcagcccagcctttgacaac
ctctattactgggaccagaactcatcggagcagggtcctccaccaagtacctttgaaggg
acccccactgcagagaaccctgagtacctaggcctggatgtgccagtatga

KEGG   Mus musculus (mouse): 13867
Entry
13867             CDS       T01002                                 

Gene name
Erbb3, C76256, Erbb, Erbb-, Erbb-3, Erbb3r, HER, Her3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13867 (Erbb3)
   04012 ErbB signaling pathway
    13867 (Erbb3)
   04020 Calcium signaling pathway
    13867 (Erbb3)
   04151 PI3K-Akt signaling pathway
    13867 (Erbb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13867 (Erbb3)
   05205 Proteoglycans in cancer
    13867 (Erbb3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13867 (Erbb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13867 (Erbb3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13867 (Erbb3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13867 (Erbb3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like CD34_antigen APH SKG6
Other DBs
NCBI-GeneID: 13867
NCBI-ProteinID: NP_034283
MGI: 95411
Ensembl: ENSMUSG00000018166
Vega: OTTMUSG00000029881
UniProt: Q61526
Position
10 D3; 10 77.1 cM
AA seq 1339 aa
MSAIGTLQVLGFLLSLARGSEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILLGGVYIEKNDKLCHMDTIDWRDIVRVPDAEIVVKNNG
GNCPPCHEVCKGRCWGPGPEDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPAPLVYNKLTFQLEPNPHIKYQYGGVCVASCPHNFVVDQTF
CVRACPADKMEVDKNGLKMCEPCRGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPAEE
RLDIKYNRPLGECVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNVLQGEP
REFVHEAHCFSCHPECQPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQAEVLMSKPHLVIAVTVGLTVIFLILGGS
FLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVFGT
VHKGIWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAVGSLDHAHIVRLLGLCPGSS
LQLVTQYLPLGSLLDHVRQHRETLGPQLLLNWGVQIAKGMYYLEEHSMVHRDLALRNVML
KSPSQVQVADFGVADLLPPDDKQLLHSEAKTPIKWMALESIHFGKYTHQSDVWSYGVTVW
ELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKELA
NEFTRMARDPPRYLVIKRASGPGIPPAAEPSALSTKELQDAELEPDLDLDLDVEVEEEGL
ATTLGSALSLPTGTLTRPRGSQSLLSPSSGYMPMNQSNLGEACLDSAVLGGREQFSRPIS
LHPIPRGRQTSESSEGHVTGSEAELQERVSMCRSRSRSRSPRPRGDSAYHSQRHSLLTPV
TPLSPPGLEEEDGNGYVMPDTHLRGTSSSREGTLSSVGLSSVLGTEEEDEDEEYEYMNRK
RRGSPARPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPMAIVPSAGTTPDEDYEYM
NRRRGAGGSGGDYAAMGACPAAEQGYEEMRAFQGPGHQAPHVRYARLKTLRSLEATDSAF
DNPDYWHSRLFPKANAQRI
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgagtgcgattgggactctgcaggtgctgggtttccttctcagcctggcccggggttcc
gagatgggcaactctcaggcagtatgtcctgggactctaaacgggctgagtgtgaccggc
gatgctgacaaccagtaccagacactgtacaaactctatgagaagtgtgaggtggtcatg
ggtaacctggagattgtgcttacgggacacaatgctgatctttccttcctgcaatggatc
cgagaagtgacaggctatgtactggtggccatgaatgaattctctgtactgcccttacct
aacctccgagtggtccggggaacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaataccaactccagccatgctctgcgccagctccggttcactcagcttact
gagattctgttagggggcgtttacattgagaagaatgacaaactttgccacatggataca
attgactggagggacatcgtgagggttccagacgctgagatagtggtgaagaacaacggg
gggaactgtccaccctgtcacgaagtctgcaaggggcgatgctgggggcctggaccagaa
gactgccagatattgaccaagaccatctgtgcccctcagtgtaacggtcgctgcttcggg
cccaatcctaaccagtgctgccacgatgaatgtgcaggtggctgctctggaccccaggac
acagattgcttcgcctgccgacacttcaatgacagtggtgcctgtgtgcccaggtgtcca
gcgccccttgtgtacaacaagctaacgttccagcttgagcccaacccccatatcaagtat
cagtacggaggagtctgtgttgccagttgtccccataactttgtggtggatcagacattt
tgtgtcagggcttgtcctgctgacaagatggaagtagataagaatggactcaagatgtgt
gagccttgcagagggctgtgcccaaaagcctgtgaggggacgggctctggaagccgctac
cagaccgtggactctagcaatatcgatgggttcgtgaactgtaccaagatcctgggcaac
ctggacttcctcatcactggcctcaatggtgacccctggcacaagatccctgcactggac
ccggaaaagctcaatgttttcaggacagtccgggagattacaggctacctaaacatccag
tcctggccccctcacatgcacaacttcagtgttttttccaacctgacgaccatcgggggc
agaagcctctacaatcggggcttctccttgttgatcatgaagaacttgaatgtcacgtct
ctgggcttccggtccctgaaggaaattagtgctgggcgtgtctacataagtgccaatcag
caactttgttaccaccactctctgaactggaccagacttctgcgggggcccgcagaggag
agacttgacatcaagtacaaccggcctctgggagaatgcgtggcagagggcaaagtgtgt
gatccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcttgt
cgaaactacagccgggaaggtgtctgtgtgactcactgcaacgttctgcaaggggaaccc
cgagagtttgttcatgaggctcattgcttctcctgccatccagaatgccagcccatggag
ggcaccagcacgtgcaatggctcgggctccgacgcttgtgctcgatgcgcccattttcgt
gatgggccccactgtgtgaacagctgcccccatggaatcctaggtgccaaaggtccaatc
tacaaatatccagatgctcagaatgagtgccggccctgccacgagaactgcacccaaggg
tgtaagggaccagaactacaagactgtttaggccaagcagaggtattaatgagcaaacca
cacctggtcatagcggtgacagtaggactgactgtgatcttcctgattctgggaggctct
tttctctattggcgtggacgcaggattcagaataaaagggctatgagacgctacttggag
cggggtgagagcatcgagcctctggacccaagcgagaaggcaaacaaagtcttggctaga
atcttcaaagagacagagctgaggaaacttaaggtgcttggctctggtgtctttggaact
gtacacaaggggatttggattcccgagggtgaatccatcaagattccagtctgcattaaa
gtcatcgaggacaagagtgggcggcagagttttcaggctgtgactgatcacatgctggcc
gtcggcagcctggaccatgcccacattgtacggctgctgggactgtgcccagggtcatct
ctgcagcttgtcactcagtacttgcctctgggctctctccttgatcatgtaagacagcac
cgtgagacactgggaccacagctgctgctcaactggggagtacaaattgccaagggtatg
tattacctcgaggaacacagcatggtgcatagggaccttgcgctccggaatgtgatgctt
aagtcaccgagtcaagtccaggtggcagattttggtgtggctgacttgctgccgccagat
gacaagcagttactacacagtgaggccaagactccaattaaatggatggcccttgagagt
atccactttgggaaatacacacaccagagtgatgtctggagttacggtgtaaccgtttgg
gagttgatgaccttcggggcagagccctacgcagggctacgactggctgaaataccagac
ctgctggagaagggagagcggttagcacagccccagatctgcaccattgacgtctacatg
gtcatggtcaagtgttggatgattgacgagaatattcgcccaacctttaaagaactggcc
aatgagtttaccaggatggcccgggacccaccaaggtatctggtcatcaagagagcgagt
gggcctggaatacctcctgcagcagagccatctgctctgagcaccaaagagttgcaggat
gcagagctggagccagacctggacctcgacctagacgtggaggtagaagaggagggcctg
gcgaccacactgggttctgccctcagcttgcctacaggaacgcttacccggccacgtggg
agccagagtcttttaagtccttcgtctggatacatgcccatgaaccagagcaaccttggg
gaggcttgtctggattctgcggttttggggggtcgcgaacagttctcccgtcccatctct
ctgcacccgatcccacgggggcgtcaaacgtcagagtcatcagagggccatgtgacgggc
tctgaggctgaactccaagagagagtatcaatgtgtaggagccggagccggagccggagc
ccacggccacgtggggacagtgcctaccattcgcagcgacacagcctgcttactcccgtc
accccgctctccccaccagggttagaggaagaggatggcaatggttatgtcatgccagat
acgcacctcagaggtacatcctcttcccgggaaggcaccctttcgtcagtaggtctcagt
tctgtgctgggtaccgaagaggaagatgaagatgaggagtatgaatacatgaaccggaag
aggaggggtagcccggctcggccccccagacctggttccctggaagagctgggctatgag
tacatggatgtgggttcagacctcagtgcttctctgggcagtacgcagagttgcccactc
catcccatggccatcgtgccctctgctggcacgactccagatgaggactatgaatacatg
aaccgcaggcgtggtgcgggcggttccggaggggattatgcagctatgggggcctgccca
gcagctgaacaagggtatgaggaaatgcgagctttccaggggcctggacatcaagccccc
catgttcgttatgcccgcctcaaaactctgcgtagtttagaagccactgactccgccttt
gacaaccccgattactggcatagcaggcttttccctaaggctaacgcccagagaatttga

KEGG   Mus musculus (mouse): 13869
Entry
13869             CDS       T01002                                 

Gene name
Erbb4, ErbB, Her, Her4, c-erbB-4
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13869 (Erbb4)
   04012 ErbB signaling pathway
    13869 (Erbb4)
   04020 Calcium signaling pathway
    13869 (Erbb4)
   04151 PI3K-Akt signaling pathway
    13869 (Erbb4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    13869 (Erbb4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    13869 (Erbb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13869 (Erbb4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13869 (Erbb4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   13869 (Erbb4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH DUF3951
Other DBs
NCBI-GeneID: 13869
NCBI-ProteinID: NP_034284
MGI: 104771
Ensembl: ENSMUSG00000062209
Vega: OTTMUSG00000025138
UniProt: Q61527
Position
1 C3; 1 33.8 cM
AA seq 1292 aa
MKLATGLWVWGSLLMAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRNQFVYQDGGFATQQGMPMPYRATTSTIPEAPVAQG
ATAEMFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERNPRGELDEEGYMTPMHD
KPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEPLYLNTFANAL
GSAEYMKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3879 nt   +upstreamnt  +downstreamnt
atgaagctggcgacgggactctgggtctgggggagccttctgatggcagcggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaacaaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatcgagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctacgtcctggtggccctcaaccagtttcgttacttgcctctggag
aatttacgcattattcgtgggacaaaactatatgaagatcgctatgccttagcgatattc
ttaaactacaggaaagatggcaactttggactccaagaacttggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgacact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
aatggaagttctggatgtggaagatgccataagtcttgcactggccgatgctggggaccc
acagaaaatcactgccagaccttgaccagaactgtgtgtgctgaacaatgtgatggcagg
tgctatggaccctacgttagtgactgctgccatcgagaatgtgctggaggctgctcagga
ccaaaggacactgactgctttgcctgcatgaacttcaatgacagtggagcctgcgttact
caatgtccccaaacatttgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacgtatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttctaagatggaagtagaagaaaatgggatt
aaaatgtgtaagccttgcaccgatatttgccccaaagcatgtgatggaatcggcacggga
tcactgatgtctgctcagactgtggattcaagtaacattgacaaattcataaactgcaca
aagatcaatggcaatctcatctttcttgtcactggcattcatggagacccttacaatgct
attgacgccatagatccagagaaactgaatgtctttcggactgtcagagaaataacaggt
ttcctgaacatacagtcttggcccccaaatatgacagatttcagtgttttctccaacctc
gtcacaattggaggaagagtcctctacagtggtctctcattgctgatcctcaaacaacaa
ggtatcacttccctacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
actgacaacagcaacctgtgttattaccataccattaactggacaacactcttcagcacc
attaaccagagaatagtgatccgagataacagaagagctgagaattgtactgctgaaggc
atggtatgcaaccacctgtgttcaaatgatggttgttggggacctgggccggaccagtgc
ctgtcatgtcggcgcttcagcaggggaaagatctgcatagagtcttgcaacctttatgat
ggggaatttcgagagtttgaaaacggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagatggactcctcacatgccatggaccgggacctgacaactgcacaaagtgc
tctcattttaaggatggtccaaactgtgtggagaaatgtccagatggcctacagggagca
aacagtttcatttttaagtatgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacacgctagaactccactgattgcagccggagtcattggaggc
ctcttcatcctggtgatcatggctttgacatttgctgtctatgtcagaagaaagagcatc
aaaaagaaacgtgctttgaggagattcctggagacagagctggtagagcccttaactccc
agtggcacggcacccaatcaagctcaacttcgcattttgaaggaaaccgaactaaagagg
gtaaaggtccttggctcgggagcttttggaaccgtttataaaggtatttgggtgcctgaa
ggtgaaacagtgaaaatccctgtggctataaagatcctcaatgaaacaactggccccaaa
gccaacgtggagttcatggatgaggctctgatcatggcaagtatggatcacccacaccta
gttcgcctattgggagtgtgtctgagtcccactatccagttggttacgcagctgatgccg
catggctgcctactggactatgttcatgaacacaaggataacattggatcacagctgctg
ttgaactggtgtgtccagattgctaagggaatgatgtacctagaagaaagacggcttgtt
catcgggatctggcagcccgcaatgtcttagtgaaatctccaaatcatgttaaaatcaca
gattttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgatggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agtgatgtttggagctatggcgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacccgagaaatccccgatttactggagaaaggagagcgtctgcct
cagcctcccatctgcactattgatgtttacatggtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaagaatggctagagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaaattcttccagaatctcttggatgaagaggatttggaagacatgatggatgctgag
gaatatttggtcccccaggctttcaacatacctcctcccatctacacatccagaacaaga
attgactccaataggaatcagtttgtgtaccaagatgggggctttgctacacaacaagga
atgcccatgccctacagagccacaaccagcaccataccagaggctccagtagctcagggt
gcaacggctgagatgtttgatgactcctgctgtaatggtaccctacgaaagccagtggca
ccccatgtccaagaggacagtagcactcagaggtatagtgctgatcccacagtgttcgcc
ccagaacggaatcctcgaggagaactggatgaagaaggctacatgactccaatgcatgac
aagcccaaacaagaatatctgaatcctgtggaagagaacccttttgtgtcccgaaggaag
aatggagatcttcaagctttagataatccggagtatcacagtgcttccagcggtccaccc
aaggcggaggatgaatacgtgaatgagcctctatacctcaacaccttcgccaatgccttg
gggagtgcagagtacatgaaaaacagtgtactgtctgtgccagagaaagccaagaaagca
tttgacaaccccgactactggaaccacagcctgccaccccggagcacccttcagcaccca
gactacctgcaggaatacagcacaaaatatttttataaacagaatggacggatccgcccc
attgtggcagagaatcctgagtacctctcggagttctcgctgaagcctggcactatgctg
ccccctccgccctacagacaccggaatactgtggtgtga

KEGG   Mus musculus (mouse): 14182
Entry
14182             CDS       T01002                                 

Gene name
Fgfr1, AW208770, Ea, Eask, FGFR, FGFR-I, FLG, Fgfr-, Fgfr-1, Flt-, Flt-2, Fr, Fr1, Hs, Hspy, MFR, bFGF-R-1, c-fgr
Definition
(RefSeq) fibroblast growth factor receptor 1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14182 (Fgfr1)
   04014 Ras signaling pathway
    14182 (Fgfr1)
   04015 Rap1 signaling pathway
    14182 (Fgfr1)
   04020 Calcium signaling pathway
    14182 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    14182 (Fgfr1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    14182 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    14182 (Fgfr1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14182 (Fgfr1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    14182 (Fgfr1)
  09159 Environmental adaptation
   04714 Thermogenesis
    14182 (Fgfr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14182 (Fgfr1)
   05205 Proteoglycans in cancer
    14182 (Fgfr1)
   05230 Central carbon metabolism in cancer
    14182 (Fgfr1)
  09162 Cancer: specific types
   05218 Melanoma
    14182 (Fgfr1)
   05215 Prostate cancer
    14182 (Fgfr1)
   05224 Breast cancer
    14182 (Fgfr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14182 (Fgfr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14182 (Fgfr1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14182 (Fgfr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14182 (Fgfr1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14182 (Fgfr1)
CD molecules [BR:mmu04090]
 Proteins
  14182 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14182 (Fgfr1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_4 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 14182
NCBI-ProteinID: NP_034336
MGI: 95522
Ensembl: ENSMUSG00000031565
Vega: OTTMUSG00000031031
UniProt: P16092 Q8CBY7
Structure
PDB: 
2CKN

Position
8 A2; 8 14.12 cM
AA seq 822 aa
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggggctggaagtgcctcctcttctgggctgtgctggtcacagccactctctgcact
gccaggccagccccaaccttgcctgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccccgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcctcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcatgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagtttaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgacgtcgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagctgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgcatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcagctgactccagtgcatccatgaactctggg
gttctcctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtc
tccgaatatgagctccctgaggatccccgctgggagctgccacgagacagactggtctta
ggcaaaccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctg
gataaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgttgaagtccgacgca
acggagaaggacctgtcggatctgatctcggagatggagatgatgaaaatgattgggaag
cacaagaatatcatcaaccttctgggagcgtgcacacaggatggtcctctttatgtcatt
gtggagtacgcctccaaaggcaatctccgggagtatctacaggcccggaggcctcctggg
ctggagtactgctataaccccagccacaaccccgaggaacagctgtcttccaaagatctg
gtatcctgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtata
caccgagacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgca
gactttggcttagctcgagacattcatcatatcgactactacaagaaaaccaccaacggc
cggctgcctgtgaagtggatggcccctgaggcgttgtttgaccggatctacacacaccag
agcgatgtgtggtcttttggagtgctcttgtgggagatcttcactctgggtggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctctcagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttg
acctccaaccaggagtatctggacctgtccataccgctggaccagtactcacccagcttt
cccgacacacggagctccacctgctcctcaggggaggactctgtcttctctcatgagccg
ttacctgaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaa
cggcgctga

KEGG   Mus musculus (mouse): 14183
Entry
14183             CDS       T01002                                 

Gene name
Fgfr2, AU043015, AW556123, Bek, Fgfr, Fgfr-, Fgfr-2, Fgfr-7, Fgfr2b, Fgfr7, KGFR, KGFRTr, svs
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14183 (Fgfr2)
   04014 Ras signaling pathway
    14183 (Fgfr2)
   04015 Rap1 signaling pathway
    14183 (Fgfr2)
   04020 Calcium signaling pathway
    14183 (Fgfr2)
   04151 PI3K-Akt signaling pathway
    14183 (Fgfr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14183 (Fgfr2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14183 (Fgfr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14183 (Fgfr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14183 (Fgfr2)
   05230 Central carbon metabolism in cancer
    14183 (Fgfr2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14183 (Fgfr2)
   05215 Prostate cancer
    14183 (Fgfr2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14183 (Fgfr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14183 (Fgfr2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14183 (Fgfr2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14183 (Fgfr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14183 (Fgfr2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14183 (Fgfr2)
CD molecules [BR:mmu04090]
 Proteins
  14183 (Fgfr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14183 (Fgfr2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM Ig_5 C2-set_2 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 14183
NCBI-ProteinID: NP_034337
MGI: 95523
Ensembl: ENSMUSG00000030849
Vega: OTTMUSG00000031222
UniProt: P21803 E9QK53
Structure
PDB: 
4HWU

Position
7; 7 F3
AA seq 840 aa
MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARTVDSETWYFMVNVTDAISSGDDEDDTDSSEDVVSENRSNQRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYT
CLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMK
TTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLA
GVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKD
DATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRP
PGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMK
IADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGG
SPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL
TLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgggattaccgtccacgtggagatatggaagaggaccagggattggcactgtgaccatg
gtcagctgggggcgcttcatctgcctggtcttggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaggataccactttagaaccagaagagccaccaaccaaa
taccaaatctcccaaccagaagcgtacgtggttgcccccggggaatcgctagagttgcag
tgcatgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtatctccagataaaaggtgccacacctagagac
tccggcctctatgcttgtactgcagctaggacggtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatctggagatgatgaggacgacacagatagctccgaa
gacgttgtcagtgagaacaggagcaaccagagagcaccgtactggaccaacaccgagaag
atggagaagcggctccacgctgtccctgccgccaacactgtgaagttccgctgtccggct
ggggggaatccaacgcccacaatgaggtggttaaaaaacgggaaggagtttaagcaggag
catcgcattggaggctataaggtacgaaaccagcactggagccttattatggaaagtgtg
gtcccgtcagacaaaggcaactacacctgcctggtggagaatgaatacgggtccatcaac
cacacctaccacctcgatgtcgttgaacggtcaccacaccggcccatcctccaagctgga
ctgcctgcaaatgcctccacggtggtcggaggggatgtggagtttgtctgcaaggtttac
agcgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcctgatgggctgccctacctcaaggtcctgaaggccgccggtgttaacaccacggac
aaagagattgaggttctctatattcggaatgtaacttttgaggatgctggggaatatacg
tgcttggcgggtaattctatcgggatatcctttcactctgcatggttgacagttctgcca
gcgcctgtgagagagaaggagatcacggcttccccagattatctggagatagctatttac
tgcataggggtcttcttaatcgcctgcatggtggtgacagtcatcttttgccgaatgaag
accacgaccaagaagccagacttcagcagccagccagctgtgcacaagctgaccaagcgc
atccccctgcggagacaggtaacagtttcggccgagtccagctcctccatgaactccaac
accccgctggtgaggataacaacgcgtctgtcctcaacagcggacaccccgatgctagca
ggggtctccgagtatgagttgccagaggatccaaagtgggaattccccagagataagctg
acgctgggcaaacccctgggggaaggttgcttcgggcaagtagtcatggctgaagcagtg
ggaatcgataaagacaaacccaaggaggcggtcaccgtggcagtgaagatgttgaaagat
gatgccacagagaaggacctgtctgatctggtatcagagatggagatgatgaagatgatt
gggaaacataagaacattatcaacctcctgggggcctgcacgcaggatggacctctctac
gtcatagttgaatatgcatcgaaaggcaacctccgggaatacctccgagcccggaggcca
cctggcatggagtactcctatgacattaaccgtgtccccgaggagcagatgaccttcaag
gacttggtgtcctgcacctaccagctggctagaggcatggagtacttggcttcccaaaaa
tgtatccatcgagatttggctgccagaaacgtgttggtaacagaaaacaatgtgatgaag
atagcagactttggcctggccagggatatcaacaacatagactactataaaaagaccaca
aatgggcgacttccagtcaagtggatggctcctgaagccctttttgatagagtttacact
catcagagcgatgtctggtccttcggggtgttaatgtgggagatctttactttagggggc
tcaccctacccagggattcccgtggaggaactttttaagctgctcaaagagggacacagg
atggacaagcccaccaactgcaccaatgaactgtacatgatgatgagggattgctggcat
gctgtaccctcacagagacccacattcaagcagttggtcgaagacttggatcgaattctg
actctcacaaccaatgaggaatacttggatctcacccagcctctcgaacagtattctcct
agttaccccgacacaaggagctcttgttcttcaggggacgattctgtgttttctccagac
cccatgccttatgaaccctgtctgcctcagtatccacacataaacggcagtgttaaaaca
tga

KEGG   Mus musculus (mouse): 14184
Entry
14184             CDS       T01002                                 

Gene name
Fgfr3, CD333, FR3, Fgfr-, Fgfr-3, Flg-2, HBGF, HBGFR, Mfr3, sa, sam3
Definition
(RefSeq) fibroblast growth factor receptor 3
  KO
K05094  fibroblast growth factor receptor 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05219  Bladder cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14184 (Fgfr3)
   04014 Ras signaling pathway
    14184 (Fgfr3)
   04015 Rap1 signaling pathway
    14184 (Fgfr3)
   04020 Calcium signaling pathway
    14184 (Fgfr3)
   04151 PI3K-Akt signaling pathway
    14184 (Fgfr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14184 (Fgfr3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14184 (Fgfr3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14184 (Fgfr3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14184 (Fgfr3)
   05206 MicroRNAs in cancer
    14184 (Fgfr3)
   05230 Central carbon metabolism in cancer
    14184 (Fgfr3)
  09162 Cancer: specific types
   05219 Bladder cancer
    14184 (Fgfr3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14184 (Fgfr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14184 (Fgfr3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14184 (Fgfr3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14184 (Fgfr3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14184 (Fgfr3)
CD molecules [BR:mmu04090]
 Proteins
  14184 (Fgfr3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM C2-set_2 Pkinase_fungal DUF1533 RIO1
Other DBs
NCBI-GeneID: 14184
NCBI-ProteinID: NP_001156687
MGI: 95524
Ensembl: ENSMUSG00000054252
Vega: OTTMUSG00000021524
UniProt: Q7TSI8
Position
5 B2; 5 17.83 cM
AA seq 800 aa
MVVPACVLVFCVAVVAGATSEPPGPEQRVVRRAAEVPGPEPSQQEQVAFGSGDTVELSCH
PPGGAPTGPTVWAKDGTGLVASHRILVGPQRLQVLNASHEDAGVYSCQHRLTRRVLCHFS
VRVTDAPSSGDDEDGEDVAEDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSI
SWLKNGKEFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVL
ERSPHRPILQAGLPANQTAILGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYV
TVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELMET
DEAGSVYAGVLSYGVVFFLFILVVAAVILCRLRSPPKKGLGSPTVHKVSRFPLKRQVSLE
SNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQV
VMAEAIGIDKDRTAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACT
QGGPLYVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGME
YLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEAL
FDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMI
MRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYSPGGQDTPSSSSSGDD
SVFTHDLLPPGPPSNGGPRT
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggtagtcccggcctgcgtgctagtgttctgcgtggcggtcgtggctggagctacttcc
gagcctcctggtccagagcagcgagttgtgcggagagcggcagaggttccagggcctgaa
cctagccagcaggagcaggtggccttcggcagtggggacaccgtggagctgagctgccat
cctcctggaggtgcccccacagggcccacggtctgggctaaggatggtacaggtctggtg
gcctcccaccgcatcctggtggggcctcagaggctgcaagtgctaaatgcctcccacgaa
gatgcaggggtctacagctgccagcaccggctcactcggcgtgtgctgtgccacttcagt
gtgcgtgtaacagatgctccatcctcaggagatgacgaagatggggaggacgtggctgaa
gacacaggggctccttattggactcgcccggagcgaatggataagaaactgctggctgtg
ccagccgcaaacactgtccgcttccgctgcccagctgctggcaaccctaccccctccatc
tcctggctgaagaatggcaaagaattccgaggggagcatcgcattgggggcatcaagctc
cggcaccagcagtggagcttggtcatggaaagtgtggtaccctccgatcgtggcaactat
acctgtgtagttgagaacaagtttggcagcatccggcagacatacacactggatgtgctg
gagcgctccccacaccggcccatcctgcaggctgggctgccggccaaccagacagccatt
ctaggcagtgacgtggagttccactgcaaggtgtacagcgatgcacagccacacatccag
tggctgaagcacgtggaagtgaacggcagcaaggtgggccctgacggcacgccctacgtc
actgtactcaagactgcaggcgctaacaccaccgacaaggagctagaggttctgtccttg
cacaatgtcacctttgaggacgcgggggagtacacctgcctggcgggcaattctattggg
ttttcccatcactctgcgtggctggtggtgctgccagctgaggaggagctgatggaaact
gatgaggctggcagcgtgtacgcaggcgtcctcagctacggggtggtcttcttcctcttc
atcctggtggtggcagctgtgatactctgccgcctgcgcagtcccccaaagaagggcttg
ggctcgcccaccgtgcacaaggtctctcgcttcccgcttaagcgacaggtgtccttggaa
tctaactcctctatgaactccaacacaccccttgtccggattgcccggctgtcctcagga
gaaggtcctgttctggccaatgtttctgaacttgagctgcctgctgaccccaagtgggag
ctatccaggacccggctgacacttggtaagcctcttggagaaggctgctttggacaggtg
gtcatggcagaagctattggcatcgacaaggaccgtactgccaagcctgtcaccgtggcc
gtgaagatgctgaaagatgatgcgactgacaaggacctgtcggacctggtatctgagatg
gagatgatgaaaatgattggcaagcacaagaacatcattaacctgctgggggcgtgcaca
cagggtgggcccctgtatgtgctggtggagtacgcagccaagggcaatctccgggagttc
cttcgggcgcggcggcctccaggcatggactactcctttgatgcctgcaggctgccagag
gaacagctcacctgcaaggatctagtgtcctgtgcctaccaggtggcacggggcatggaa
tacttggcttctcagaagtgtattcacagagacttggctgccagaaacgtcctggtgacc
gaggacaatgtgatgaagattgcggactttggcctggctcgagatgtgcacaacctggac
tactacaagaagaccacaaatggccggctacctgtgaagtggatggcaccagaggccctt
tttgaccgagtctacacccaccagagtgatgtttggtcttttggtgtcctcctctgggag
atctttacgctggggggctcaccgtatcctggcatcccagtggaagagcttttcaagctg
ttgaaagagggccaccgcatggacaagccagccagctgcacacatgacctgtacatgatc
atgcgggaatgttggcatgcggtgccttcacagaggcccaccttcaagcagttggtagag
gatttagaccgcatcctcactgtgacatcaaccgacgagtacttggacctctccgtgccg
tttgagcagtactcgccaggtggccaggacacgcctagctccagctcgtccggagatgac
tcggtgttcacccatgacctgctacccccaggtccacccagtaacgggggacctcggacg
tga

KEGG   Mus musculus (mouse): 14186
Entry
14186             CDS       T01002                                 

Gene name
Fgfr4, Fgfr-, Fgfr-4
Definition
(RefSeq) fibroblast growth factor receptor 4
  KO
K05095  fibroblast growth factor receptor 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14186 (Fgfr4)
   04014 Ras signaling pathway
    14186 (Fgfr4)
   04015 Rap1 signaling pathway
    14186 (Fgfr4)
   04020 Calcium signaling pathway
    14186 (Fgfr4)
   04151 PI3K-Akt signaling pathway
    14186 (Fgfr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14186 (Fgfr4)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14186 (Fgfr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14186 (Fgfr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14186 (Fgfr4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14186 (Fgfr4)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14186 (Fgfr4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14186 (Fgfr4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14186 (Fgfr4)
CD molecules [BR:mmu04090]
 Proteins
  14186 (Fgfr4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig V-set C2-set_2 Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 14186
NCBI-ProteinID: NP_032037
MGI: 95525
Ensembl: ENSMUSG00000005320
Vega: OTTMUSG00000035043
UniProt: Q03142 A0A0R4IZY3
Position
13 B1; 13 29.8 cM
AA seq 799 aa
MWLLLALLSIFQGTPALSLEASEEMEQEPCLAPILEQQEQVLTVALGQPVRLCCGRTERG
RHWYKEGSRLASAGRVRGWRGRLEIASFLPEDAGRYLCLARGSMTVVHNLTLLMDDSLTS
ISNDEDPKTLSSSSSGHVYPQQAPYWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPMPTIH
WLKDGQAFHGENRIGGIRLRHQHWSLVMESVVPSDRGTYTCLVENSLGSIRYSYLLDVLE
RSPHRPILQAGLPANTTAVVGSDVELLCKVYSDAQPHIQWLKHVVINGSSFGADGFPYVQ
VLKTTDINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGLSYQSAWLTVLPEEDLTWTTATP
EARYTDIILYVSGSLVLLVLLLLAGVYHRQVIRGHYSRQPVTIQKLSRFPLARQFSLESR
SSGKSSLSLVRGVRLSSSGPPLLTGLVNLDLPLDPLWEFPRDRLVLGKPLGEGCFGQVVR
AEAFGMDPSRPDQTSTVAVKMLKDNASDKDLADLVSEMEVMKLIGRHKNIINLLGVCTQE
GPLYVIVECAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYL
ESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFD
RVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMR
ECWHAAPSQRPTFKQLVEALDKVLLAVSEEYLDLRLTFGPFSPSNGDASSTCSSSDSVFS
HDPLPLEPSPFPFSDSQTT
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgtggctgctcttggccctgttgagcatctttcaggggacaccagctttgtcccttgag
gcctctgaggaaatggagcaggagccctgcctagccccaatcctggagcagcaagagcag
gtgttgacggtggccctggggcagcctgtgaggctgtgctgtgggcgcaccgagcgtggt
cgtcactggtacaaagagggcagccgcctagcatctgctgggcgagtacggggttggaga
ggccgcctggagatcgccagcttccttcctgaggatgctggccgatacctctgcctggcc
cgtggctccatgaccgtcgtacacaatcttacgttgcttatggatgactccttaacctcc
atcagtaatgatgaagaccccaagacactcagcagctcctcgagtggtcatgtctaccca
cagcaagcaccctactggacacacccccaacgcatggagaagaaactgcatgcagtgcct
gccgggaatactgtcaaattccgctgtccagctgcagggaaccccatgcctaccatccac
tggctcaaggatggacaggccttccacggggagaatcgtattggaggcattcggctgcgc
caccaacactggagcctggtgatggaaagtgtggtaccctcggaccgtggcacatacaca
tgccttgtggagaactctctgggtagcattcgctacagctatctcctggatgtgctggag
cggtccccgcaccggcccatcctgcaggcggggctcccagccaacaccacagctgtggtt
ggcagcgatgtggagctactctgcaaggtgtacagcgacgcccagccccacatacagtgg
ctgaaacacgtcgtcatcaacggcagcagcttcggcgccgacggtttcccctacgtacaa
gtcctgaagacaacagacatcaatagctcggaggtagaggtcttgtatctgaggaacgtg
tccgctgaggatgcaggagagtatacctgtctggcgggcaactccatcggcctttcctac
cagtcagcgtggctcacggtgctgccagaggaagacctcacgtggacaacagcaacccct
gaggccagatacacagatatcatcctgtatgtatcaggctcactggttctgcttgtgctc
ctgctgctggccggggtgtatcatcggcaagtcatccgtggccactactctcgccagcct
gtcactatacaaaagctgtcccgtttccctttggcccgacagttctctttggagtcgagg
tcctctggcaagtcaagtttgtccctggtgcgaggtgtccgtctctcctccagcggcccg
cccttgctcacgggccttgtgaatctagacctgcctctcgatccgctttgggaattcccc
cgggacaggttggtgctcggaaagcccctgggtgagggctgctttgggcaagtggttcgt
gcagaggcctttggtatggatccctcccggcccgaccaaaccagcaccgtggctgtgaag
atgctgaaagacaatgcctccgacaaggatttggcagacctggtctccgagatggaggtg
atgaagctaatcggaagacacaagaacatcatcaacctgctgggtgtctgcactcaggaa
gggcccctgtacgtgattgtggaatgtgccgccaagggaaaccttcgggaattcctccgt
gcccggcgccccccaggccctgatctcagccctgatggacctcggagcagcgaaggacca
ctctccttcccggccctagtctcctgtgcctaccaggtggcccgaggcatgcagtatctg
gagtctcggaagtgcatccaccgggacctggctgcccgaaatgtgctggtgaccgaggat
gatgtgatgaagatcgctgactttgggctggcacgtggtgtccaccacattgactactat
aagaaaaccagcaacggccgcctgccagtcaaatggatggctccagaggcattgttcgac
cgcgtgtacacacaccagagtgacgtgtggtctttcgggatcctgctgtgggaaatcttc
accctcgggggctccccataccctggcattccggtggaggagctcttctcactgctgcga
gaggggcacaggatggagcggcccccaaactgcccctcagagctgtatgggctaatgagg
gagtgctggcacgcagccccatctcagaggcctacttttaagcagctggtggaagctctg
gacaaggtcctgctggctgtctctgaagagtaccttgacctccgcctgacctttggaccc
ttttctccctccaatggggatgccagcagcacctgctcctccagtgactcggttttcagc
cacgaccctttgcccctcgagccaagccccttccctttctctgactcgcagacgacatga

KEGG   Mus musculus (mouse): 14254
Entry
14254             CDS       T01002                                 

Gene name
Flt1, AI323757, Flt-, Flt-1, VEGF, VEGFR, VEGFR-1, VEGFR1, sFl, sFlt1
Definition
(RefSeq) FMS-like tyrosine kinase 1
  KO
K05096  FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05202  Transcriptional misregulation in cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14254 (Flt1)
   04014 Ras signaling pathway
    14254 (Flt1)
   04015 Rap1 signaling pathway
    14254 (Flt1)
   04066 HIF-1 signaling pathway
    14254 (Flt1)
   04020 Calcium signaling pathway
    14254 (Flt1)
   04151 PI3K-Akt signaling pathway
    14254 (Flt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14254 (Flt1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    14254 (Flt1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14254 (Flt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14254 (Flt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14254 (Flt1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   14254 (Flt1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase ig Ig_2 V-set VEGFR-2_TMD Ig_6 C1-set Ig_4 Ig_5 Izumo-Ig Herpes_gE
Other DBs
NCBI-GeneID: 14254
NCBI-ProteinID: NP_034358
MGI: 95558
Ensembl: ENSMUSG00000029648
Vega: OTTMUSG00000021385
UniProt: P35969 A0A0R4J0A4
Position
5 G3; 5 87.01 cM
AA seq 1333 aa
MVSCWDTAVLPYALLGCLLLTGYGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKRLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKK
AESSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKKFPFDTLTP
DGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYLTHRQTNTILDVQIRPPSP
VRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVFHSVLKIN
NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKV
KAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLT
ATLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPCHHNHSKER
YDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVSTLVVADSQTPGIYSCRAFN
KIGTVERNIKFYVTDVPNGFHVSLEKMPAEGEDLKLSCVVNKFLYRDITWILLRTVNNRT
MHHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSE
APHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIE
RVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEVKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDS
VSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRRGDTRLPLKWMAPESIFDKVYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDCWHKD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTRNSGFTYSTPTFSEDLFKDGFAD
PHFHSGSSDDVRYVNAFKFMSLERIKTFEELSPNSTSMFEDYQLDTSTLLGSPLLKRFTW
TETKPKASMKIDLRIASKSKEAGLSDLPRPSFCFSSCGHIRPVQDDESELGKESCCSPPP
DYNSVVLYSSPPA
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggtcagctgctgggacaccgcggtcttgccttacgcgctgctcgggtgtctgcttctc
acaggatatggctcagggtcgaagttaaaagtgcctgaactgagtttaaaaggcacccag
catgtcatgcaagcaggccagactctctttctcaagtgcagaggggaggcagcccactca
tggtctctgcccacgaccgtgagccaggaggacaaaaggctgagcatcactcccccatcg
gcctgtgggagggataacaggcaattctgcagcaccttgaccttggacacggcgcaggcc
aaccacacgggcctctacacctgtagatacctccctacatctacttcgaagaaaaagaaa
gcggaatcttcaatctacatatttgttagtgatgcagggagtcctttcatagagatgcac
actgacatacccaaacttgtgcacatgacggaaggaagacagctcatcatcccctgccgg
gtgacgtcacccaacgtcacagtcaccctaaaaaagtttccatttgatactcttacccct
gatgggcaaagaataacatgggacagtaggagaggctttataatagcaaatgcaacgtac
aaagagataggactgctgaactgcgaagccaccgtcaacgggcacctgtaccagacaaac
tatctgacccatcggcagaccaatacaatcctagatgtccaaatacgcccgccgagccca
gtgagactgctccacgggcagactcttgtcctcaactgcaccgccaccacggagctcaat
acgagggtgcaaatgagctggaattaccctggtaaagcaactaagagagcatctataagg
cagcggattgaccggagccattcccacaacaatgtgttccacagtgttcttaagatcaac
aatgtggagagccgagacaaggggctctacacctgtcgcgtgaagagtgggtcctcgttc
cagtctttcaacacctccgtgcatgtgtatgaaaaaggattcatcagtgtgaaacatcgg
aagcagccggtgcaggaaaccacagcaggaagacggtcctatcggctgtccatgaaagtg
aaggccttcccctccccagaaatcgtatggttaaaagatggctcgcctgcaacattgaag
tctgctcgctatttggtacatggctactcattaattatcaaagatgtgacaaccgaggat
gcaggggactatacgatcttgctgggcataaagcagtcaaggctatttaaaaacctcact
gccactctcattgtaaacgtgaaacctcagatctacgaaaagtccgtgtcctcgcttcca
agcccacctctctatccgctgggcagcagacaagtcctcacttgcaccgtgtatggcatc
cctcggccaacaatcacgtggctctggcacccctgtcaccacaatcactccaaagaaagg
tatgacttctgcactgagaatgaagaatcctttatcctggatcccagcagcaacttagga
aacagaattgagagcatctctcagcgcatgacggtcatagaaggaacaaataagacggtt
agcacattggtggtggctgactctcagacccctggaatctacagctgccgggccttcaat
aaaatagggactgtggaaagaaacataaaattttatgtcacagatgtgccgaatggcttt
cacgtttccttggaaaagatgccagccgaaggagaggacctgaaactgtcctgtgtggtc
aataaattcctgtacagagacattacctggattctgctacggacagttaacaacagaacc
atgcaccatagtatcagcaagcaaaaaatggccaccactcaagattactccatcactctg
aaccttgtcatcaagaacgtgtctctagaagactcgggcacctatgcgtgcagagccagg
aacatatacacaggggaagacatccttcggaagacagaagttctcgttagagattcggaa
gcgccacacctgcttcaaaacctcagtgactacgaggtctccatcagtggctctacgacc
ttagactgtcaagctagaggtgtccccgcgcctcagatcacttggttcaaaaacaaccac
aaaatacaacaagaaccgggaattattttaggaccaggaaacagcacgctgtttattgaa
agagtcacagaggaggatgagggtgtctataggtgccgagccaccaaccagaagggggcc
gtggaaagcgcagcctacctcaccgtgcaaggaacctcagacaagtcaaacctggagctg
atcacgctcacgtgcacatgcgtggctgcgaccctcttttggctccttctaactctcttc
atcagaaaactgaagcggtcttcttccgaagtaaagacagactacctgtcaatcattatg
gacccagatgaagttcccctggatgagcagtgtgaacggctgccctatgatgccagcaag
tgggagtttgcacgggagagactgaaactaggcaaatcgctcggaagaggggcttttggg
aaagtcgttcaagcctctgcatttggcattaagaaatcacccacctgccggactgtggct
gtgaagatgttgaaagagggggccacagccagtgagtacaaagctctgatgaccgaactc
aagatcttgacccacatcggccatcatctgaatgtggttaacctcctgggagcctgcacg
aagcaaggagggcctctgatggtgatcgtggaatactgcaaatacggaaacctgtccaac
tacctcaagagcaaacgtgacttattctgtctcaacaaggacgcagccttgcatatggag
ctcaagaaagagagcctggaaccaggcctggagcagggccagaagccccgcctagacagt
gtcagcagctcaagtgtcaccagctccagcttccctgaagaccgaagcgtgagcgatgtg
gaaggagacgaggattacagtgagatctccaagcagcccctcaccatggaagacctgatt
tcctacagtttccaagtggccagaggcatggagtttctgtcctccagaaagtgcattcat
cgggacctggcagcgagaaacatccttttatctgagaacaatgtggtgaagatttgcgac
tttggcctggcccgggatatttataagaaccctgattatgtgaggagaggagatactcga
cttcccctaaaatggatggctcctgaatccatctttgacaaggtctacagcaccaagagc
gatgtgtggtcctatggcgtgttgctgtgggagatcttctccttagggggttctccatac
ccaggagtgcaaatggatgaagacttctgcagccgcctgaaggaaggcatgcggatgaga
accccggagtatgccacacctgaaatctaccaaatcatgttggattgctggcacaaagac
cccaaagagaggccccggtttgctgaacttgtggagaaacttggtgacctgcttcaagcc
aacgtccaacaggatgggaaagattacatccccctcaatgccatactgactagaaacagt
ggcttcacatactcgacccccaccttctctgaggaccttttcaaggacggctttgcagat
ccacattttcattccggaagctctgatgatgtgagatatgtaaacgctttcaaattcatg
agcctggaaagaatcaaaacctttgaggagctttcaccgaactccacctccatgtttgag
gactatcagctggacactagcactctgctgggctcccccttgctgaagcggttcacctgg
actgagaccaagcccaaggcctccatgaagatagacttgagaatagcgagtaaaagcaag
gaggcgggactttccgatctgccgaggcccagcttctgcttctccagctgtggccacatc
aggcccgtgcaggacgatgaatctgagctgggaaaggagtcctgctgttctccaccccca
gactacaactccgtggtgttgtactcctccccgcccgcctaa

KEGG   Mus musculus (mouse): 14255
Entry
14255             CDS       T01002                                 

Gene name
Flt3, B230315G04, CD135, Flk, Flk-, Flk-2, Flk2, Flt-, Flt-3, Ly72, wmf, wmfl
Definition
(RefSeq) FMS-like tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14255 (Flt3)
   04014 Ras signaling pathway
    14255 (Flt3)
   04151 PI3K-Akt signaling pathway
    14255 (Flt3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14255 (Flt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14255 (Flt3)
   05202 Transcriptional misregulation in cancer
    14255 (Flt3)
   05230 Central carbon metabolism in cancer
    14255 (Flt3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    14255 (Flt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14255 (Flt3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14255 (Flt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14255 (Flt3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   14255 (Flt3)
CD molecules [BR:mmu04090]
 Proteins
  14255 (Flt3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 APH
Other DBs
NCBI-GeneID: 14255
NCBI-ProteinID: NP_034359
MGI: 95559
Ensembl: ENSMUSG00000042817
Vega: OTTMUSG00000020408
UniProt: Q00342 Q3UEW6 Q3TQF1
Position
5 86.88 cM; 5 G3
AA seq 1000 aa
MRALAQRSDRRLLLLVVLSVMILETVTNQDLPVIKCVLISHENNGSSAGKPSSYRMVRGS
PEDLQCAPRRQSEGTVYEAATVEVAESGSITLQVQLATPGDLSCLWVFKHSSLGCQPHFD
LQNRGIVSMAILNVTETQAGEYLLHIQSEAANYTVLFTVNVRDTQLYVLRRPYFRKMENQ
DALLCISEGVPEPTVEWVLCSSHRESCKEEGPAVVRKEEKVLHELFGTDIRCCARNALGR
ECTKLFTIDLNQAPQSTLPQLFLKVGEPLWIRCKAIHVNHGFGLTWELEDKALEEGSYFE
MSTYSTNRTMIRILLAFVSSVGRNDTGYYTCSSSKHPSQSALVTILEKGFINATSSQEEY
EIDPYEKFCFSVRFKAYPRIRCTWIFSQASFPCEQRGLEDGYSISKFCDHKNKPGEYIFY
AENDDAQFTKMFTLNIRKKPQVLANASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEIP
EGVWNKKANRKVFGQWVSSSTLNMSEAGKGLLVKCCAYNSMGTSCETIFLNSPGPFPFIQ
DNISFYATIGLCLPFIVVLIVLICHKYKKQFRYESQLQMIQVTGPLDNEYFYVDFRDYEY
DLKWEFPRENLEFGKVLGSGAFGRVMNATAYGISKTGVSIQVAVKMLKEKADSCEKEALM
SELKMMTHLGHHDNIVNLLGACTLSGPVYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFK
EHNFSFYPTFQAHSNSSMPGSREVQLHPPLDQLSGFNGNLIHSEDEIEYENQKRLAEEEE
EDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIL
SDSSYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDAN
FYKLIQSGFKMEQPFYATEGIYFVMQSCWAFDSRKRPSFPNLTSFLGCQLAEAEEAMYQN
MGGNVPEHPSIYQNRRPLSREAGSEPPSPQAQVKIHGERS
NT seq 3003 nt   +upstreamnt  +downstreamnt
atgcgggcgttggcgcagcgcagcgaccggcggctgctgctgcttgttgttttgtcagta
atgattcttgagaccgttacaaaccaagacctgcctgtgatcaagtgtgttttaatcagt
catgagaacaatggctcatcagcgggaaagccatcatcgtaccgaatggtgcgaggatcc
ccagaagacctccagtgtgccccgaggcgccagagtgaagggacggtatatgaagcggcc
accgtggaggtggccgagtctgggtccatcaccctgcaagtgcagctcgccaccccaggg
gacctttcctgcctctgggtctttaagcacagctccctgggctgccagccgcactttgat
ttacaaaacagaggaatcgtttccatggccatcttgaacgtgacagagacccaggcagga
gaatacctactccatattcagagcgaagccgccaactacacagtactgttcacagtgaat
gtaagagatacacagctgtacgtgctaagaagaccttactttaggaagatggaaaaccag
gacgcactgctctgcatctccgagggtgttccagagcccactgtggagtgggtgctctgc
agctcccacagggaaagctgtaaagaagaaggccctgctgttgtcagaaaggaggaaaag
gtacttcatgagttgttcggaacagacatcagatgctgtgctagaaatgcactgggccgc
gaatgcaccaagctgttcaccatagatctaaaccaggctcctcagagcacactgccccag
ttattcctgaaagtgggggaacccttgtggatcaggtgtaaggccatccatgtgaaccat
ggattcgggctcacctgggagctggaagacaaagccctggaggagggcagctactttgag
atgagtacctactccacaaacaggaccatgattcggattctcttggcctttgtgtcttcc
gtgggaaggaacgacaccggatattacacctgctcttcctcaaagcaccccagccagtca
gcgttggtgaccatcctagaaaaagggtttataaacgctaccagctcgcaagaagagtat
gaaattgacccgtacgaaaagttctgcttctcagtcaggtttaaagcgtacccacgaatc
cgatgcacgtggatcttctctcaagcctcatttccttgtgaacagagaggcctggaggat
gggtacagcatatctaaattttgcgatcataagaacaagccaggagagtacatattctat
gcagaaaatgatgacgcccagttcaccaaaatgttcacgctgaatataagaaagaaacct
caagtgctagcaaatgcctcagccagccaggcgtcctgttcctctgatggctacccgcta
ccctcttggacctggaagaagtgttcggacaaatctcccaattgcacggaggaaatccca
gaaggagtttggaataaaaaggctaacagaaaagtgtttggccagtgggtgtcgagcagt
actctaaatatgagtgaggccgggaaagggcttctggtcaaatgctgtgcgtacaattct
atgggcacgtcttgcgaaaccatctttttaaactcaccaggccccttccctttcatccaa
gacaacatctccttctatgcgaccattgggctctgtctccccttcattgttgttctcatt
gtgttgatctgccacaaatacaaaaagcaatttaggtacgagagtcagctgcagatgatc
caggtgactggccccctggataacgagtacttctacgttgacttcagggactatgaatat
gaccttaagtgggagttcccgagagagaacttagagtttgggaaggtcctggggtctggc
gctttcgggagggtgatgaacgccacggcctatggcattagtaaaacgggagtctcaatt
caggtggcggtgaagatgctaaaagagaaagctgacagctgtgaaaaagaagctctcatg
tcggagctcaaaatgatgacccacctgggacaccatgacaacatcgtgaatctgctgggg
gcatgcacactgtcagggccagtgtacttgatttttgaatattgttgctatggtgacctc
ctcaactacctaagaagtaaaagagagaagtttcacaggacatggacagagatttttaag
gaacataatttcagtttttaccctactttccaggcacattcaaattccagcatgcctggt
tcacgagaagttcagttacacccgcccttggatcagctctcagggttcaatgggaattta
attcattctgaagatgagattgaatatgaaaaccagaagaggctggcagaagaagaggag
gaagatttgaacgtgctgacgtttgaagacctcctttgctttgcgtaccaagtggccaaa
ggcatggaattcctggagttcaagtcgtgtgtccacagagacctggcagccaggaatgtg
ttggtcacccacgggaaggtggtgaagatctgtgactttggactggcccgagacatcctg
agcgactccagctacgtcgtcaggggcaacgcacggctgccggtgaagtggatggcacct
gagagcttatttgaagggatctacacaatcaagagtgacgtctggtcctacggcatcctt
ctctgggagatattttcactgggtgtgaacccttaccctggcattcctgtcgacgctaac
ttctataaactgattcagagtggatttaaaatggagcagccattctatgccacagaaggg
atatactttgtaatgcaatcctgctgggcttttgactcaaggaagcggccatccttcccc
aacctgacttcatttttaggatgtcagctggcagaggcagaagaagcgatgtatcagaac
atgggtggcaacgtcccagaacatccatccatctaccaaaacaggcggcccctcagcaga
gaggcaggctcagagccgccatcgccacaggcccaggtgaagattcacggagaaagaagt
tag

KEGG   Mus musculus (mouse): 14257
Entry
14257             CDS       T01002                                 

Gene name
Flt4, AI323512, Chy, Flt-, Flt-4, VEGF, VEGFR, VEGFR-3, VEGFR3
Definition
(RefSeq) FMS-like tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14257 (Flt4)
   04014 Ras signaling pathway
    14257 (Flt4)
   04015 Rap1 signaling pathway
    14257 (Flt4)
   04020 Calcium signaling pathway
    14257 (Flt4)
   04151 PI3K-Akt signaling pathway
    14257 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14257 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14257 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    14257 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14257 (Flt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14257 (Flt4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   14257 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set
Other DBs
NCBI-GeneID: 14257
NCBI-ProteinID: NP_032055
MGI: 95561
Ensembl: ENSMUSG00000020357
Vega: OTTMUSG00000005554
UniProt: P35917 Q5SU94
Position
11 B1.2; 11 29.69 cM
AA seq 1363 aa
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDG
QEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSM
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQR
DGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRS
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQRRRF
RAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEERMALHSSQSSEEDGFM
QASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEELPM
TPTTYKASMDNQTDSGMVLASEEFEELESRHRPEGSFSCKGPGQHMDIPRGHPDPQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggttactccatgacccctccaaccctgaacatcacagaggattcatatgtg
attgacaccggggacagcctatccatatcctgcaggggacagcaccccctcgagtggacc
tggccaggggcccaggaggtactgaccacaggtgggaaggacagtgaagacacacgggtt
gtgcatgactgtgaaggcacagaagctaggccctactgcaaggtgctactgctggcccag
actcacgccaacaacacgggcagctaccactgctactacaagtacatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttaaacaccctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccggcctcaacatcacactgcgctcgcaaagctcagcgctgcaccccgacggg
caggaggtgctgtgggatgaccgccggggcatgcgggtgcccactcaactgttgcgcgat
gccctgtacctgcagtgcgagaccacctggggtgaccagaacttcctttccaatctcttc
gtcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcaatg
gagctgttggttggagagaagctggttttgaactgtacagtgtgggctgagttcgactca
ggtgtcaccttcgactgggattatccagggaagcaggcagagcgggctaagtgggtacct
gagcggcgttcccagcagacccacacagaactctccagcatcctgaccatccacaatgtc
agccagaatgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacagaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagctggtgaagctacccgtgaagctggcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccccatgctctggtgctcaaagaggtgaccgaggccagcgcaggggtctacactctcgcc
ctgtggaactctgcagctggtctgaggcaaaacatcagtctggagctggtggtgaatgtg
cctcctcacatccacgaaaaggaagcctcttcacccagcatctactcccgccacagtcgc
cagaccctcacctgcaccgcctatggagtaccccaacccctcagtgtccagtggcactgg
aggccctggacaccctgcaagacgtttgcccagcgcagcctccggaggcggcagcagcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggatgctgtgaacccc
atcgagagtctggacagctggacggagtttgtggaggggaagaataagacggtgagcaag
ctggtgatccaggatgccaatgtgtcagccatgtacaagtgtgtggtcgtcaacaaagtg
ggccaggatgagagactcatctacttctatgtgaccaccatcccggacggtttcagtatc
gagtcggagccttctgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtacgaacatctgcgctggtaccggctcaacctctccacactgcacgat
gctcaagggaaccccctattgctggactgcaaaaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcagagcccggggcccgccacgccaccctcagtttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaagtgcaggataggcgcagc
caggacaagcactgccacaagaagtacctgtccgtgcaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgcccg
gtggctggagcgcatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccagcgcgtgcgcgag
gaggacgcaggtcgttatctgtgcagcgtgtgcaatgccaagggctgcgtaaactcctct
gccagcgtggcagtggaaggctctgaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagttttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgccagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccacggggcttttgggaaggtggtg
gaagcctcagcttttggcatcaataaaggcagcagctgtgacaccgtggctgtgaagatg
ctgaaagagggcgctactgccagcgagcaccgtgccctgatgtcggagctcaagatccta
attcacatcggcaaccatctcaacgtggtcaacctcctaggggcgtgcaccaagcccaac
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggacacgttcaacccctacgcggagaagtctccggagcaacgcaggcgcttc
cgcgccatggtagaaggcgccaaagctgataggaggagacctggaagcagcgacagggcc
ctgttcacgcggttcctgatgggcaaaggaagtgcacggcgagccccacttgtccaagaa
gctgaggacctatggctgagcccactgaccatggaagaccttgtatgctacagcttccaa
gttgcccggggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacatcctactgtcagaaagtgacatagtgaagatctgcgactttggcctcgctcgg
gacatctacaaagaccccgactatgtccgaaagggcagtgcccgacttcctctgaaatgg
atggcccccgagagcatctttgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggcgtgctgctgtgggagatcttctcattgggggcctctccataccctggggtacagatc
aatgaggagttctgccagcggctgaaggatggcactcgaatgagagccccggaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcaagacct
gctttctctgacctagtggagatcctgggggacctgcttcagggcggaggctggcaggag
gaggaagaggagcgcatggccctgcacagctctcagagctccgaggaggatggcttcatg
caggcatccaccacagctctacatatcaccgaagcagacgctgatgatagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gccagaggcactaagactccaggctcttccaggatgaagacatttgaagaattgcccatg
acccctacaacctacaaagcctccatggataaccagacagacagcgggatggtgctggcc
tcagaagagtttgaggagctagaaagcaggcatagaccagaaggcagcttcagctgtaaa
ggtcctggccagcacatggatattcccagaggacaccctgacccccaggggaggcggcga
cggcccactcaaggggcacaaggaggcaaggtgttttataacaacgagtatggggaggtc
tcccagccatgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcagctactaa

KEGG   Mus musculus (mouse): 16001
Entry
16001             CDS       T01002                                 

Gene name
Igf1r, A330103N21Rik, CD221, D930020L01, IGF-, IGF-1R, hyft
Definition
(RefSeq) insulin-like growth factor I receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04144  Endocytosis
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16001 (Igf1r)
   04014 Ras signaling pathway
    16001 (Igf1r)
   04015 Rap1 signaling pathway
    16001 (Igf1r)
   04066 HIF-1 signaling pathway
    16001 (Igf1r)
   04068 FoxO signaling pathway
    16001 (Igf1r)
   04151 PI3K-Akt signaling pathway
    16001 (Igf1r)
   04152 AMPK signaling pathway
    16001 (Igf1r)
   04150 mTOR signaling pathway
    16001 (Igf1r)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    16001 (Igf1r)
   04140 Autophagy - animal
    16001 (Igf1r)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16001 (Igf1r)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16001 (Igf1r)
   04520 Adherens junction
    16001 (Igf1r)
   04550 Signaling pathways regulating pluripotency of stem cells
    16001 (Igf1r)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16001 (Igf1r)
   04914 Progesterone-mediated oocyte maturation
    16001 (Igf1r)
  09156 Nervous system
   04730 Long-term depression
    16001 (Igf1r)
  09149 Aging
   04211 Longevity regulating pathway
    16001 (Igf1r)
   04213 Longevity regulating pathway - multiple species
    16001 (Igf1r)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16001 (Igf1r)
   05202 Transcriptional misregulation in cancer
    16001 (Igf1r)
   05205 Proteoglycans in cancer
    16001 (Igf1r)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16001 (Igf1r)
   05214 Glioma
    16001 (Igf1r)
   05218 Melanoma
    16001 (Igf1r)
   05215 Prostate cancer
    16001 (Igf1r)
   05224 Breast cancer
    16001 (Igf1r)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16001 (Igf1r)
   01522 Endocrine resistance
    16001 (Igf1r)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16001 (Igf1r)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16001 (Igf1r)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16001 (Igf1r)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   16001 (Igf1r)
CD molecules [BR:mmu04090]
 Proteins
  16001 (Igf1r)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD B2 DUF4476
Other DBs
NCBI-GeneID: 16001
NCBI-ProteinID: NP_034643
MGI: 96433
Ensembl: ENSMUSG00000005533
Vega: OTTMUSG00000059602
UniProt: Q60751 E9QNX9
Structure
PDB: 
6PYH

Position
7 C; 7 37.27 cM
AA seq 1369 aa
MKSGSGGGSPTSLWGLVFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGFLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTIDWSLILDAVSNNYIVGNKPPKECGD
LCPGTLEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSVCGKRACTENNECCHPECLGSCH
TPDDNTTCVACRHYYYKGVCVPACPPGTYRFEGWRCVDRDFCANIPNAESSDSDGFVIHD
DECMQECPSGFIRNSTQSMYCIPCEGPCPKVCGDEEKKTKTIDSVTSAQMLQGCTILKGN
LLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYS
FYVLDNQNLQQLWDWNHRNLTVRSGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINT
RNNGERASCESDVLRFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYD
GQDACGSNSWNMVDVDLPPNKEGEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKS
EILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPTLPNGNLSYYIVRWQRQPQDGYLYR
HNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGDKGPCCACPKTEAEKQAEKEEAEYR
KVFENFLHNSIFVPRPERRRRDVMQVANTTMSSRSRNTTVADTYNITDPEEFETEYPFFE
SRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVT
WEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPG
NYTARIQATSLSGNGSWTDPVFFYVPAKTTYENFMHLIIALPVAILLIVGGLVIMLYVFH
RKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMNRELGQGSFGMVYEGVAK
GVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIM
ELMTRGDLKSYLRSLRPEVEQNNLVLIPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSF
GVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIIGSIKDEMEPSFQEVSFYYSEENKPPEPEELEMEPENMESVPLDPSASSASLPLPE
RHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRANERALPLPQSSTC
NT seq 4110 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcgtgtttctctcc
gccgcgctctctctctggccgacgagtggagaaatctgtgggcccggcattgacatccgc
aacgactatcagcagctgaagcgcctggaaaactgcacggtgatcgagggcttcctccac
atcctgctcatctccaaggccgaggactaccgaagctaccgcttccccaagctcaccgtc
atcactgagtacttgctgctcttccgagtcgctggcctcgagagcctgggagacctcttc
cccaacctcacagtcatccgtggctggaaactcttctacaactacgcactggtcatcttc
gagatgaccaatctcaaggatattgggctttataatctgaggaacattactcggggggcc
atcaggattgagaagaacgccgacctctgttacctctccaccatagactggtctctcatc
ttggatgcggtgtccaataactacattgtggggaacaagcccccgaaggaatgtggggac
ctgtgtccagggacattggaggagaagcccatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaatcgctgccagaaaatgtgcccaagtgtgtgcggg
aagcgagcctgcaccgagaacaacgagtgctgccacccggagtgcctgggcagctgccac
acaccggacgacaacacaacctgcgtggcctgcagacactactactacaaaggcgtgtgt
gtgcctgcctgcccgcctggcacctacaggttcgagggctggcgctgtgtggatcgcgat
ttctgcgccaacatccccaacgctgagagcagtgactcggatggcttcgttatccacgac
gatgagtgcatgcaggagtgtccctcaggcttcatccgcaacagcacccagagcatgtac
tgtatcccctgcgaaggcccctgccccaaagtctgcggcgatgaagagaagaaaacgaaa
accatcgattcggtgacttctgctcaaatgctccaaggatgcaccatcctgaagggcaat
ctgcttattaacatccggagaggcaataacattgcctcggagttggagaacttcatgggg
ctcatcgaggtggtgaccggctacgtgaagatccgccattctcatgccttggtctccttg
tccttcctgaagaaccttcgtctcatcttaggagaggagcagctggaagggaactactcc
ttctatgtcctagacaaccagaacttgcagcagctgtgggactggaaccaccggaacctg
accgtcaggtccggaaagatgtactttgctttcaatcccaagctgtgtgtctccgaaatt
taccgcatggaggaagtgaccggaaccaagggacgccagagcaaaggggacataaacacc
aggaacaacggagagcgagcttcctgtgaaagtgatgttctccgtttcacctccaccacg
acctggaagaaccgaatcatcataacgtggcaccggtaccggccgccggactaccgggat
ctcatcagcttcacagtttactacaaggaggcaccatttaaaaacgttacggaatatgac
gggcaggatgcctgtggctccaacagctggaacatggtggatgtagacctgcctccgaac
aaggagggcgagcctggcattttactgcatgggctgaagccctggacccagtatgctgtc
tatgtcaaggctgtgaccctcaccatggtggaaaacgaccatatccgtggggccaaaagt
gaaatcttgtacattcgcaccaatgcttcagtcccttccattcccctagatgtcctctca
gcatcaaactcttcctctcagctgattgtgaagtggaatcctccaactctgcccaatggt
aacttgagttactacattgtgaggtggcagcggcagccccaggatggttacctgtaccgg
cacaactactgctccaaagacaaaatacccatcagaaagtacgccgatggtaccatcgac
gtggaggaggtgacggaaaatcccaagacagaagtgtgtggtggtgataaagggccatgc
tgcgcttgccctaaaactgaagctgagaagcaggctgagaaggaggaggctgagtaccgt
aaagtctttgagaatttccttcacaattccatctttgtgcccaggcccgaaaggaggcgg
agagacgtcatgcaagtggccaacacgaccatgtccagccgaagcaggaacaccacggta
gctgacacctacaatatcacagacccggaggagttcgagacagagtaccctttctttgag
agcagagtggataacaaggagaggactgtcatctccaacctccggcctttcactctgtac
cgcatcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaac
ttcgtctttgcgagaaccatgccagcagaaggagcagatgatatccctggtccggtgacc
tgggagccaagacccgaaaactccatctttttaaagtggccagaacccgagaaccccaac
ggattgatcctaatgtatgaaattaaatacgggtcgcaagtcgaggatcagcgggaatgt
gtgtccagacaggagtacaggaagtacggaggggccaaactcaaccgtctaaacccaggg
aactatacagcccggattcaggctacctccctctctgggaatgggtcatggacagatcct
gtgttcttctatgtccccgccaaaacgacgtatgagaacttcatgcatctgatcattgct
ctgccggttgccatcctgctgatcgttggggggctggttatcatgctgtatgtcttccat
agaaagagaaataacagcaggttgggcaatggagtgctgtatgcttctgtgaaccccgag
tatttcagcgcagctgatgtgtacgtgcctgatgaatgggaggtagctcgagagaagatc
accatgaaccgggagctcggacaagggtcctttgggatggtctatgaaggagtggccaag
ggtgtggtcaaggatgaacccgaaaccagagtggccatcaagacggtaaacgaggctgca
agtatgcgtgaaagaatcgagtttctcaacgaggcctcggtgatgaaggagttcaattgt
caccatgtggtccggttgctgggtgtggtatcccaaggccagcccaccctggtcatcatg
gaactaatgacacgcggtgatctcaaaagttatctccggtctctgaggccagaagtggag
cagaataatctagtcctcattcctccgagcttaagcaagatgatccagatggctggagag
attgcagatggcatggcctacctcaatgccaacaagttcgtccacagagaccttgctgct
aggaactgcatggtagccgaagatttcacagtcaaaattggagatttcggtatgacacga
gacatctacgagacggactactaccggaaaggcgggaaggggttgctgcctgtgcgctgg
atgtctcccgagtccctcaaggatggtgtcttcactactcattctgatgtctggtccttc
ggggtcgtcctctgggagatcgccacgctggctgagcagccctaccagggcttgtccaac
gagcaagttcttcgtttcgtcatggagggtggccttctggacaagccggacaactgccct
gatatgctgtttgaacttatgcgcatgtgctggcagtataaccccaagatgcggccctcc
ttcctggagatcatcggcagcatcaaggatgagatggagcccagcttccaggaggtctcc
ttctactacagcgaggagaacaagcctcccgagccagaggagctggagatggagcctgag
aacatggagagcgtcccactggacccttcggcctcctcagcctccctgcctctgcctgaa
agacactcaggacacaaggctgagaatggcccgggccctggcgtgctcgttctccgcgcc
agttttgatgagagacagccttacgctcacatgaacgggggacgcgccaacgagagggcc
ttgcctctgccccagtcctcgacctgctga

KEGG   Mus musculus (mouse): 16337
Entry
16337             CDS       T01002                                 

Gene name
Insr, 4932439J01Rik, CD220, D630014A15Rik, I, IR, IR-A, IR-B
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04520  Adherens junction
mmu04910  Insulin signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16337 (Insr)
   04014 Ras signaling pathway
    16337 (Insr)
   04015 Rap1 signaling pathway
    16337 (Insr)
   04066 HIF-1 signaling pathway
    16337 (Insr)
   04068 FoxO signaling pathway
    16337 (Insr)
   04072 Phospholipase D signaling pathway
    16337 (Insr)
   04022 cGMP-PKG signaling pathway
    16337 (Insr)
   04151 PI3K-Akt signaling pathway
    16337 (Insr)
   04152 AMPK signaling pathway
    16337 (Insr)
   04150 mTOR signaling pathway
    16337 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    16337 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16337 (Insr)
   04923 Regulation of lipolysis in adipocytes
    16337 (Insr)
   04913 Ovarian steroidogenesis
    16337 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16337 (Insr)
  09149 Aging
   04211 Longevity regulating pathway
    16337 (Insr)
   04213 Longevity regulating pathway - multiple species
    16337 (Insr)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16337 (Insr)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16337 (Insr)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16337 (Insr)
   04932 Non-alcoholic fatty liver disease
    16337 (Insr)
   04931 Insulin resistance
    16337 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16337 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16337 (Insr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16337 (Insr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   16337 (Insr)
CD molecules [BR:mmu04090]
 Proteins
  16337 (Insr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like Insulin_TMD fn3 Kinase-like DUF4476
Other DBs
NCBI-GeneID: 16337
NCBI-ProteinID: NP_034698
MGI: 96575
Ensembl: ENSMUSG00000005534
Vega: OTTMUSG00000031438
UniProt: P15208 Q3TPM5
Position
8 A1.1; 8 1.82 cM
AA seq 1372 aa
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
RSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS
NT seq 4119 nt   +upstreamnt  +downstreamnt
atgggcttcgggagaggatgtgagacgacggctgtgccattgctggtggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgccctggtatggacatc
cggaacaacctgaccaggctacatgagctggagaactgctcagtcattgagggccatctg
cagatcctcctgatgttcaagaccagacccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcacagattacctgcttctcttccgtgtctatggtctggaaagtctgaaa
gacctcttcccaaatctcacagtcatccgaggctcccgtctcttcttcaactatgccctg
gttatcttcgagatggtccacctgaaggagctggggctttataacctcatgaacatcacc
cggggctctgtccgcatcgagaagaataatgagctctgctacctggccactatcgactgg
tcccgtatcctggattctgtggaggacaactacattgtactgaacaaagatgacaacgag
gaatgtggggatgtctgtccaggcaccgccaagggcaagaccaactgtcctgccactgtc
atcaatgggcagtttgtggaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgcacagctgaaggcctgtgctgccacaaagagtgcctg
ggcaactgttcggaacctgatgaccccaccaagtgtgtggcctgtcgcaacttctatctg
gatggtcagtgtgtggagacctgcccgccaccctactatcacttccaggactggcgctgt
gtgaacttcagcttctgccaagaccttcacttcaaatgcaggaactctcggaagcctggc
tgccaccaatacgtcattcacaacaataagtgcatccccgagtgcccgtctggctatacc
atgaattccagcaacttgatgtgcaccccatgtctgggaccctgccctaaggtctgccaa
atcctcgaaggtgagaagaccattgattctgtgacatctgcccaggagctccgaggctgc
actgtgatcaacggtagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctggaggctaaccttggcctcattgaagaaatttcgggatttctaaagatccgccgctcc
tatgctctggtatcactttctttcttcaggaagctacatctgattcgaggagagaccttg
gaaattgggaactattctttttatgccttggacaaccagaacctgaggcaactctgggac
tggagcaaacacaacctcaccatcactcagggcaagctcttcttccattacaacccgaaa
ctctgcttgtctgaaattcacaagatggaagaagtctccggaactaagggccgtcaggag
aggaacgacattgccctgaagaccaatggggaccaggcatcgtgtgaaaatgaattgctt
aaattttctttcattcggacatcttttgacaagatcctgttgaggtgggaaccctactgg
ccccccgacttccgagatctcctgggattcatgttgttctacaaagaggccccttatcag
aatgtgacagagtttgatgggcaggatgcttgtggctccaacagctggactgtggtggat
attgacccgccccagaggtccaacgaccccaagtctcagaccccaagccaccctgggtgg
ctgatgcggggcctcaaaccctggacccaatacgccatctttgtgaagaccttggttacc
ttctctgatgaacggcggacctatggagccaaaagtgatatcatctatgtgcaaacagat
gccactaatccttctgtccccctggatcccatatcagtttctaattcctcatctcagatt
atcttaaagtggaagcccccctctgaccccaatggcaacatcacacactacctggtgtac
tgggagaggcaagcagaggacagcgagctgtttgagctggattattgtctcaaagggctg
aagctcccttcacggacctggtccccaccctttgagtctgatgattctcagaagcacaat
cagagtgagtatgacgactcggccagtgagtgctgctcatgccctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgtccccaggccatcccgaaagcgaagatcccttgaagaggtggggaatgtg
acagccaccacactcacacttccagatttccccaacgtctcctctaccattgtgcccaca
agtcaggaggagcacaggccatttgagaaagtggtgaacaaggagtcacttgtcatctct
ggcctgagacacttcactgggtaccgcattgagctgcaggcatgcaatcaagattcccca
gatgagaggtgcagtgtggctgcctacgtcagtgcccggaccatgcctgaagctaaggca
gatgacatcgttggccctgtgactcatgaaatctttgagaacaatgttgtacacttaatg
tggcaagagccaaaggaacctaatggtctgattgtgctatatgaagtgagctatcgccga
tatggtgatgaggagctgcacctctgtgtctcccggaagcattttgccctggagcggggc
tgcaggctgcgagggctctccccaggaaactacagtgttcgagtccgggctacctctctg
gcaggaaatggctcctggacagaacccacctatttttatgtgactgattatttagatgtc
ccatcaaatattgccaaaattatcattggacccctcatctttgtcttcctcttcagtgtt
gtgattggaagtatttatctatttctgagaaagaggcagccggatgggccaatgggacca
ctgtatgcatcttcaaaccctgagtacctcagtgccagtgatgtgtttccatcttctgtg
tacgtgccggacgagtgggaggtgcctcgagagaagatcacccttcttcgagagctgggg
cagggatcctttggtatggtgtatgaaggcaatgccaaggatatcatcaagggtgaggca
gagacccgtgttgcggttaagactgtcaatgagtcagccagtcttcgagaacggatcgag
ttcctcaatgaggcatcagtcatgaagggattcacctgccatcatgtggtccgccttctt
ggggtggtatccaaaggacagccaacgctggtagtgatggaattgatggctcatggagac
ctgaaaagtcacctccgttctctgaggccagatgctgagaataacccaggccgccctccc
cctaccttgcaagaaatgattcagatgacagcagaaattgctgatggcatggcatacttg
aacgccaagaagtttgtgcaccgggacctggcagctcgaaactgcatggttgcccatgat
tttactgtcaaaattggagactttggaatgacaagggacatctacgagacagattactat
cggaaagggggcaagggactgcttcctgtgaggtggatgtcacctgagtccctgaaggat
ggagtctttactgcttcttctgatatgtggtcctttggggtggtcctttgggaaatcact
agcctggctgagcaaccttatcaaggcctgtctaatgaacaggtgttgaagtttgtcatg
gatggaggctatctggatccccctgataactgtccagagagactcactgacctgatgcgc
atgtgctggcagttcaaccccaagatgaggccaaccttcctggaaatcgtcaacctgctc
aaggatgacctccaccccagctttccagaagtttccttcttctacagcgaggagaacaag
gctcctgagagtgaggagctggagatggagtttgaagacatggagaatgtcccgttggat
cgttcctctcactgtcagagagaagaggctgggggccgggagggagggtcctcactgagc
atcaaacggacctatgatgaacacatcccctatacccacatgaatgggggcaagaagaac
ggacgtgtccttaccctgccaaggtcaaacccttcctaa

KEGG   Mus musculus (mouse): 16542
Entry
16542             CDS       T01002                                 

Gene name
Kdr, 6130401C07, Flk, Flk-, Flk-1, Flk1, Krd-1, Ly73, VEGF, VEGFR, VEGFR-2, VEGFR2, orv, sVEGFR-2
Definition
(RefSeq) kinase insert domain protein receptor
  KO
K05098  kinase insert domain protein receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16542 (Kdr)
   04014 Ras signaling pathway
    16542 (Kdr)
   04015 Rap1 signaling pathway
    16542 (Kdr)
   04370 VEGF signaling pathway
    16542 (Kdr)
   04020 Calcium signaling pathway
    16542 (Kdr)
   04151 PI3K-Akt signaling pathway
    16542 (Kdr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16542 (Kdr)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    16542 (Kdr)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16542 (Kdr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16542 (Kdr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16542 (Kdr)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16542 (Kdr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16542 (Kdr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   16542 (Kdr)
CD molecules [BR:mmu04090]
 Proteins
  16542 (Kdr)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Ig_5 C2-set_2
Other DBs
NCBI-GeneID: 16542
NCBI-ProteinID: NP_001350145
MGI: 96683
Ensembl: ENSMUSG00000062960
Vega: OTTMUSG00000021297
Position
5 C3.3; 5 40.23 cM
AA seq 673 aa
MESKALLAVALWFCVETRAASVGLPGDFLHPPKLSTQKDILTILANTTLQITCRGQRDLD
WLWPNAQRDSEERVLVTECGGGDSIFCKTLTIPRVVGNDTGAYKCSYRDVDIASTVYVYV
RDYRSPFIASVSDQHGIVYITENKNKTVVIPCRGSISNLNVSLCARYPEKRFVPDGNRIS
WDSEIGFTLPSYMISYAGMVFCEAKINDETYQSIMYIVVVVGYRIYDVILSPPHEIELSA
GEKLVLNCTARTELNVGLDFTWHSPPSKSHHKKIVNRDVKPFPGTVAKMFLSTLTIESVT
KSDQGEYTCVASSGRMIKRNRTFVRVHTKPFIAFGSGMKSLVEATVGSQVRIPVKYLSYP
APDIKWYRNGRPIESNYTMIVGDELTIMEVTERDAGNYTVILTNPISMEKQSHMVSLVVN
VPPQIGEKALISPMDSYQYGTMQTLTCTVYANPPLHHIQWYWQLEEACSYRPGQTSPYAC
KEWRHVEDFQGGNKIEVTKNQYALIEGKNKTVSTLVIQAANVSALYKCEAINKAGRGERV
ISFHVIRGPEITVQPAAQPTEQESVSLLCTADRNTFENLTWYKLGSQATSVHMGESLTPV
CKNLDALWKLNGTMFSNSTNDILIVAFQNASLQDQGDYVCSAQDKKTKKRHCLVKQLIIL
GMEASLGDRIAMP
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggagagcaaggcgctgctagctgtcgctctgtggttctgcgtggagacccgagccgcc
tctgtgggtttgcctggcgattttctccatccccccaagctcagcacacagaaagacata
ctgacaattttggcaaatacaacccttcagattacttgcaggggacagcgggacctggac
tggctttggcccaatgctcagcgtgattctgaggaaagggtattggtgactgaatgcggc
ggtggtgacagtatcttctgcaaaacactcaccattcccagggtggttggaaatgatact
ggagcctacaagtgctcgtaccgggacgtcgacatagcctccactgtttatgtctatgtt
cgagattacagatcaccattcatcgcctctgtcagtgaccagcatggcatcgtgtacatc
accgagaacaagaacaaaactgtggtgatcccctgccgagggtcgatttcaaacctcaat
gtgtctctttgcgctaggtatccagaaaagagatttgttccggatggaaacagaatttcc
tgggacagcgagataggctttactctccccagttacatgatcagctatgccggcatggtc
ttctgtgaggcaaagatcaatgatgaaacctatcagtctatcatgtacatagttgtggtt
gtaggatataggatttatgatgtgattctgagccccccgcatgaaattgagctatctgcc
ggagaaaaacttgtcttaaattgtacagcgagaacagagctcaatgtggggcttgatttc
acctggcactctccaccttcaaagtctcatcataagaagattgtaaaccgggatgtgaaa
ccctttcctgggactgtggcgaagatgtttttgagcaccttgacaatagaaagtgtgacc
aagagtgaccaaggggaatacacctgtgtagcgtccagtggacggatgatcaagagaaat
agaacatttgtccgagttcacacaaagccttttattgctttcggtagtgggatgaaatct
ttggtggaagccacagtgggcagtcaagtccgaatccctgtgaagtatctcagttaccca
gctcctgatatcaaatggtacagaaatggaaggcccattgagtccaactacacaatgatt
gttggcgatgaactcaccatcatggaagtgactgaaagagatgcaggaaactacacggtc
atcctcaccaaccccatttcaatggagaaacagagccacatggtctctctggttgtgaat
gtcccaccccagatcggtgagaaagccttgatctcgcctatggattcctaccagtatggg
accatgcagacattgacatgcacagtctacgccaaccctcccctgcaccacatccagtgg
tactggcagctagaagaagcctgctcctacagacccggccaaacaagcccgtatgcttgt
aaagaatggagacacgtggaggatttccaggggggaaacaagatcgaagtcaccaaaaac
caatatgccctgattgaaggaaaaaacaaaactgtaagtacgctggtcatccaagctgcc
aacgtgtcagcgttgtacaaatgtgaagccatcaacaaagcgggacgaggagagagggtc
atctccttccatgtgatcaggggtcctgaaattactgtgcaacctgctgcccagccaact
gagcaggagagtgtgtccctgttgtgcactgcagacagaaatacgtttgagaacctcacg
tggtacaagcttggctcacaggcaacatcggtccacatgggcgaatcactcacaccagtt
tgcaagaacttggatgctctttggaaactgaatggcaccatgttttctaacagcacaaat
gacatcttgattgtggcatttcagaatgcctctctgcaggaccaaggcgactatgtttgc
tctgctcaagataagaagaccaagaaaagacattgcctggtcaaacagctcatcatccta
ggtatggaggcatccctgggtgacagaattgcaatgccttaa

KEGG   Mus musculus (mouse): 16590
Entry
16590             CDS       T01002                                 

Gene name
Kit, Bs, CD117, Fdc, Gsfs, Gsfsco1, Gsfsco5, Gsfsow3, SC, SCO1, SCO5, SO, SOW3, Ssm, Tr-k, Tr-kit, W, belly, c-KI, c-KIT
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04916  Melanogenesis
mmu05200  Pathways in cancer
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16590 (Kit)
   04014 Ras signaling pathway
    16590 (Kit)
   04015 Rap1 signaling pathway
    16590 (Kit)
   04072 Phospholipase D signaling pathway
    16590 (Kit)
   04151 PI3K-Akt signaling pathway
    16590 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16590 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    16590 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16590 (Kit)
   05230 Central carbon metabolism in cancer
    16590 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    16590 (Kit)
   05224 Breast cancer
    16590 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16590 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16590 (Kit)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16590 (Kit)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   16590 (Kit)
CD molecules [BR:mmu04090]
 Proteins
  16590 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_4 Ig_5 V-set Ig_6 APH UPF0220 DUF2039 Pkinase_fungal C1-set
Other DBs
NCBI-GeneID: 16590
NCBI-ProteinID: NP_001116205
MGI: 96677
Ensembl: ENSMUSG00000005672
Vega: OTTMUSG00000016671
UniProt: P05532
Structure
PDB: 
2O26

Position
5 C3.3; 5 39.55 cM
AA seq 979 aa
MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCID
PDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFL
VGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAY
HRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVS
TSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFG
SANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSAN
KGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILT
YDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSS
IDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTPLLIGFVVAAGAMG
IIVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGA
GAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLL
GACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEAALYKNLLHSTEPSCDSS
NEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLDDLLSFSYQVAK
GMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAP
ESIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAE
MYDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRV
NSVGSSASSTQPLLVHEDA
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcgtcctgttggtcctgctccgtggc
cagacagccacgtctcagccatctgcaagtccaggggagccgtctccgccatccatccat
ccagcacaatcagagttaatagttgaagctggcgacaccctcagcctgacgtgcattgat
cccgactttgtcagatggactttcaagacctatttcaatgaaatggttgagaataaaaaa
aatgaatggatccaggaaaaagccgaggccactcgcacgggcacatacacgtgcagcaac
agcaatggcctcacgagttctatttacgtgtttgttagagatcctgccaaacttttcctg
gttggccttcccttgtttggcaaagaagacagcgacgcgctggtccgctgccctctgaca
gacccacaggtgtccaattattccctcatcgagtgtgatgggaaatctctccccacggac
ctgacgtttgtcccaaaccccaaggctggcatcaccatcaaaaacgtgaagcgcgcctac
caccggctctgtgtccgctgtgctgctcagcgtgacggtacatggctgcattctgacaaa
ttcaccctcaaagtgcgggcagccatcaaggctatccctgttgtgtctgtgcctgaaaca
agtcacctccttaagaaaggggacacatttacggtggtgtgcaccataaaagatgtgtct
acatccgtgaactccatgtggctaaagatgaaccctcagcctcagcacatagcccaggta
aagcacaatagctggcaccggggtgacttcaattatgaacgccaggagacgctgactatc
agctcggcaagagttgacgattctggagtgttcatgtgttatgccaataatacttttgga
tcagcaaatgtcacaacaaccttgaaagtagtagaaaaaggattcatcaacatctcccct
gtgaagaacactacagtatttgtaaccgatggagaaaacgtagatttggttgttgaatac
gaggcctaccccaaacccgagcaccagcagtggatatatatgaacaggacctcggctaac
aaagggaaggattatgtcaaatctgataacaaaagcaacatcagatatgtgaaccaactt
cgcctgaccagattaaaaggcacagaaggaggcacttatacctttctggtgtccaactct
gatgccagtgcttccgtgacattcaacgtttacgtgaacacaaaaccagaaatcctgacg
tacgacaggctcataaatggcatgctccagtgtgtggcagagggattcccggagcccaca
atagattggtatttttgtacaggagcagagcaaaggtgtaccactcctgtctcaccagtg
gacgtacaggtccagaatgtatctgtgtcaccatttggaaaactggtggttcagagttcc
atagactccagcgtcttccggcacaacggcacggtggagtgtaaggcctccaacgatgtg
ggcaagagttccgccttctttaactttgcatttaaaggtaacaacaaagagcaaatccag
gcccacactctgttcacgccgctgctcattggctttgtggttgcagctggcgcgatgggg
atcattgtgatggtgctcacctacaaatatttgcagaaacccatgtatgaagtacaatgg
aaggttgtcgaggagataaatggaaacaattatgtttacatagacccgacgcaacttcct
tatgatcacaaatgggagtttcccagaaacaggctgagttttggaaagacattgggagct
ggtgccttcgggaaggtcgttgaggccactgcatatggcttgattaagtcggatgctgcc
atgacagttgccgtgaagatgctcaaaccaagtgcccatttaacagaaagagaggcccta
atgtcggaactgaaggtcctgagctacctgggcaatcacatgaatattgtgaacctgctt
ggcgcatgcacggtgggagggcccaccctggtcattacagaatattgttgctatggtgat
cttttgaattttttgagaaggaagcgtgactcgtttattttctcaaagcaagaagagcag
gcagaagcggcactttataagaaccttctgcactcaacggagccttcctgtgacagttca
aatgaatatatggacatgaagcctggcgtttcctacgtggtgccaaccaagacagacaag
aggagatccgcaagaatagactcgtacatagaaagagacgtgactcctgccatcatggaa
gatgacgagctggctctggacctggatgatttgctgagcttctcctaccaggtggccaag
ggcatggcgttcctcgcctccaagaattgtattcacagagatttggcagccaggaatatc
ctcctcactcacgggcggatcacaaagatttgcgatttcgggctagccagagacatcagg
aatgattcgaattacgtggtcaaaggaaatgcacgactgcccgtgaagtggatggcacca
gagagcattttcagctgcgtgtacacatttgaaagtgatgtctggtcctatgggattttc
ctctgggagctcttctccttaggaagcagcccctacccagggatgccggtcgactccaag
ttctacaagatgatcaaggaaggcttccggatggtcagcccggagcacgcgcctgccgaa
atgtatgacgtcatgaagacttgctgggacgctgaccccttgaaaaggccaacattcaag
caggttgtccaacttattgagaagcagatctcggacagcaccaagcacatttactccaac
ttggcaaactgcaaccccaacccagagaaccccgtggtggtggaccattccgtgagggtc
aactcggtgggcagcagcgcctcttctacgcagcccctgctcgtgcacgaagatgcctga

KEGG   Mus musculus (mouse): 17295
Entry
17295             CDS       T01002                                 

Gene name
Met, AI838057, HGF, HGFR, P, Par4, c-Met
Definition
(RefSeq) met proto-oncogene
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu05100  Bacterial invasion of epithelial cells
mmu05144  Malaria
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05218  Melanoma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17295 (Met)
   04014 Ras signaling pathway
    17295 (Met)
   04015 Rap1 signaling pathway
    17295 (Met)
   04020 Calcium signaling pathway
    17295 (Met)
   04151 PI3K-Akt signaling pathway
    17295 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17295 (Met)
   04520 Adherens junction
    17295 (Met)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    17295 (Met)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17295 (Met)
   05202 Transcriptional misregulation in cancer
    17295 (Met)
   05206 MicroRNAs in cancer
    17295 (Met)
   05205 Proteoglycans in cancer
    17295 (Met)
   05230 Central carbon metabolism in cancer
    17295 (Met)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    17295 (Met)
   05226 Gastric cancer
    17295 (Met)
   05218 Melanoma
    17295 (Met)
   05211 Renal cell carcinoma
    17295 (Met)
   05223 Non-small cell lung cancer
    17295 (Met)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    17295 (Met)
  09174 Infectious disease: parasitic
   05144 Malaria
    17295 (Met)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    17295 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17295 (Met)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     17295 (Met)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  MET family
   17295 (Met)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Pkinase_fungal Kinase-like SKG6
Other DBs
NCBI-GeneID: 17295
NCBI-ProteinID: NP_032617
MGI: 96969
Ensembl: ENSMUSG00000009376
Vega: OTTMUSG00000024024
UniProt: F8VQL0 A4FUV6
Position
6 A2; 6 7.83 cM
AA seq 1379 aa
MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSKANSSGGVWKDNINMAL
LVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILFGVFAQSKPDSAEPVNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHLTPHVNFLL
DSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRFDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTSDEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHE
VGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISIGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt   +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgtccttggtgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
tatcagctccccaacttcacggcagaaacccccatccagaatgtcgtcctacacggccat
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatccgaattcaagaccgggcccgtgttggaacacccagattgtttaccttgtcgggac
tgcagcagcaaagccaattcatcaggaggggtttggaaagacaacatcaacatggctctg
cttgttgacacatactatgatgatcaactcattagctgtggcagtgtcaacagagggact
tgccagcggcatgtccttcctcctgacaattctgctgacatccagtctgaggtccactgc
atgttctccccagaagaggagtcagggcagtgtcctgactgtgtagtgagtgccctcgga
gccaaagtcctcctgtcggaaaaggaccggttcatcaatttctttgtggggaatacgatc
aattcctcctatcctcctggttattcactgcattcgatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgacagaccagtcctatattgatgtcttaccagaattc
caagattcctaccccataaagtacatacatgccttcgaaagcaaccattttatttacttt
ctgactgtccaaaaggaaactctagatgctcagacttttcatacaagaataatcaggttc
tgttccgtagactctgggttgcactcctacatggaaatgcccctggaatgcatcctgaca
gaaaaaagaaggaagagatccacaagggaagaagtgtttaatatcctccaagccgcgtat
gtcagtaaaccaggggccaatcttgctaagcaaataggagctagcccttctgatgacatt
ctcttcggggtgtttgcacaaagcaagccagattctgctgaacctgtgaatcgatcagca
gtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aacgtgagatgtctccagcatttttacggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttccggctgtgaagcgcgcagtgacgagtatcggacagagtttacc
acggctttgcagcgcgtcgacttattcatgggccggcttaaccaagtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtggtgctctctcgaacagcacacctcactcctcatgtgaacttcctcctg
gactcccatcctgtatctccagaagttattgttgagcatccatcaaatcaaaatggctat
acattggttgtcacaggaaagaagatcaccaagattccattgaatggcctgggctgtgga
catttccaatcctgcagtcagtgcctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttttgatgaatgccccagcggtacatggactcaagagatctgt
ctgccggcggtttataaggtgttccccaccagcgcgccccttgaaggaggaacagtgttg
accatatgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccgcgatgagtgagcacttcaatgtgtctgtaattatctca
aacagtcgagagacgacgcaatacagtgcattctcctatgtagatcctgtaataacaagc
atttctccgaggtacggccctcaggctggaggcaccttactcactcttactgggaaatac
ctcaacagtggcaattctagacacatttcaattggagggaaaacatgtactttaaaaagt
gtatcagatagtattcttgaatgctacaccccagcccaaactacctctgatgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctgaactcggttagcctcccaaagctggtaatagatgtgcatgaa
gtgggtgtgaactacacagtggcatgtcagcatcgctcaaattcagagatcatctgctgc
actactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggattctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaataggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccactggcactctggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgttcttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcggtctcaata
tcagtagtagttttgttattatccgggctcttcctgtggatgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactacagagatggtttcaaatgagtctgtagac
tacagagctacttttccagaagaccagtttcccaactcctctcagaatggagcatgcaga
caagtgcaataccctctgacagacctgtcccctatcctgacaagtggagactctgatata
tccagcccattactacaaaatactgttcacattgacctcagtgctctaaatccagagctg
gtccaagcagttcagcacgtagtgattggacccagcagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgctggacaatgacgga
aagaaaattcactgtgctgtgaaatccttaaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaatcatcatgaaagacttcagccatcccaatgttctctcactc
ttgggaatctgcctgaggagtgaagggtctcctctggtggtcctgccctatatgaagcat
ggagatctgcgaaatttcattcgaaacgagactcataatccaactgtgaaagatcttata
ggatttggccttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agagacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaaggttgctgat
ttcggtcttgccagagacatgtacgataaagagtactatagtgtccacaacaagacgggt
gccaagctaccagtaaagtggatggctttagagagtctgcaaacgcagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacgagaggagcccct
ccttatcccgacgtgaacacatttgatatcactatctacctgttgcaaggcagaagactc
ttgcaaccagaatactgtccagacgccttgtacgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccgtccttttccgaactggtctccaggatatcctcaatcttctcc
acgttcattggggaacactacgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgatggcgaggggaacacatga

KEGG   Mus musculus (mouse): 18053
Entry
18053             CDS       T01002                                 

Gene name
Ngfr, LN, LNGFR, Tnfrs, Tnfrsf16, p7, p75, p75N, p75NGFR, p75NTR
Definition
(RefSeq) nerve growth factor receptor (TNFR superfamily, member 16)
  KO
K02583  tumor necrosis factor receptor superfamily member 16
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04215  Apoptosis - multiple species
mmu04722  Neurotrophin signaling pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18053 (Ngfr)
   04014 Ras signaling pathway
    18053 (Ngfr)
   04015 Rap1 signaling pathway
    18053 (Ngfr)
   04151 PI3K-Akt signaling pathway
    18053 (Ngfr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18053 (Ngfr)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    18053 (Ngfr)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18053 (Ngfr)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18053 (Ngfr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    18053 (Ngfr)
   04090 CD molecules [BR:mmu04090]
    18053 (Ngfr)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   18053 (Ngfr)
CD molecules [BR:mmu04090]
 Proteins
  18053 (Ngfr)
SSDB
Motif
Pfam: TNFR_16_TM TNFR_c6 Death TPR_21
Other DBs
NCBI-GeneID: 18053
NCBI-ProteinID: NP_150086
MGI: 97323
Ensembl: ENSMUSG00000000120
Vega: OTTMUSG00000001661
UniProt: Q9Z0W1
Position
11 D; 11 59.01 cM
AA seq 427 aa
MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPC
GANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDE
ETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQL
RECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMG
SSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPE
GEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSE
STATSPV
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaggagggcaggtgctgcctgcagcgccatggaccggctgcgcctgctgctgctgctg
ctgctgcttctaggggtgtcctttggaggtgccaaggagacatgttccacaggcatgtac
acccacagtggagagtgctgcaaagcctgcaacctgggcgaaggtgtggcccagccttgc
ggagccaaccagaccgtgtgtgaaccctgcctggacagtgttacgttctctgacgtggtg
agcgccaccgagccgtgcaagccgtgcaccgagtgcctgggcctgcagagtatgtccgct
ccctgtgtggaggcagacgatgccgtgtgccgatgctcctatggctactaccaggacgag
gagactggccgctgcgaggcttgcagcgtgtgcggggtgggctcaggactcgtgttctcc
tgccaggacaaacagaacacagtgtgtgaagagtgcccagagggcacatactcagatgaa
gccaaccacgtggacccgtgcctaccctgcacggtgtgcgaggacactgagcgccagtta
cgcgagtgcacgccctgggctgacgccgaatgcgaggagatccctggccgatggatcaca
aggtctacgcccccggagggctctgacgtcacaacacccagcacccaggagccggaggca
cctccagagcgagacctcatagccagcacagtggccgatacggtgaccactgtgatgggc
agctcccagcctgtagtgacccgaggcaccgctgacaacctcattcctgtctattgctcc
atcttggctgctgtggttgtgggccttgtggcctatattgctttcaagagatggaacagc
tgcaagcaaaataaacaaggagccaacagccggccggtgaaccagacacccccaccagag
ggagagaaactgcacagcgacagcggcatctctgtggacagccagagcctgcacgaccag
cagacccacacacagactgcctcaggccaagccctcaagggtgatggcaacctctacagt
agcctgcccctgaccaagcgtgaggaggtcgagaagctgctcaatggtgacacctggcga
catctggcaggcgagctgggctaccagccggagcatatagactcctttacccacgaggcc
tgcccagtccgagccctgctggccagctggggtgcccaggacagcgcgacgctcgatgcc
cttttagccgccctgcgacgcatccagagagctgacattgtggagagcctgtgcagcgag
tccactgccacgtcccctgtgtga

KEGG   Mus musculus (mouse): 18211
Entry
18211             CDS       T01002                                 

Gene name
Ntrk1, C80751, Tk, Tkr, Tr, TrkA, trk
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18211 (Ntrk1)
   04014 Ras signaling pathway
    18211 (Ntrk1)
   04020 Calcium signaling pathway
    18211 (Ntrk1)
   04151 PI3K-Akt signaling pathway
    18211 (Ntrk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18211 (Ntrk1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18211 (Ntrk1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18211 (Ntrk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18211 (Ntrk1)
   05202 Transcriptional misregulation in cancer
    18211 (Ntrk1)
   05230 Central carbon metabolism in cancer
    18211 (Ntrk1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    18211 (Ntrk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18211 (Ntrk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18211 (Ntrk1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18211 (Ntrk1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 LRR_8 I-set Ig_3 Ig_2 TrkA_TMD LRR_4 C2-set_2
Other DBs
NCBI-GeneID: 18211
NCBI-ProteinID: NP_001028296
MGI: 97383
Ensembl: ENSMUSG00000028072
Vega: OTTMUSG00000051890
UniProt: Q3UFB7
Position
3 F1; 3 38.62 cM
AA seq 799 aa
MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGPSGLRCTRAGSLDTLR
GLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHL
NLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGP
GDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADWILTELEGAATV
KKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGLAVEQHH
WCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFG
VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLS
PTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQD
KMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDL
NRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCL
VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVL
WEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDV
HARLQALAQAPPSYLDVLG
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgctgcgaggccagcggctcgggcagctgggctggcatcgcccggccgcggggctaggc
agtctgatgacttcgttgatgctggcctgtgcctccgccgcatcctgtcgcgaggtctgc
tgtcccgtgggcccctcggggctgcgctgcaccagggcagggtccctggataccctccgc
ggcctgcggggcgccgggaacctgacggagctctacgtggaaaaccagcagcacctgcaa
cgcttggagtttgaggacctgcagggcctgggggagttgagaagcctaaccatcgtgaag
agtggcctccgctttgtggccccagatgccttccgtttcacccctcggctcagtcacctg
aatctgtcctccaatgcgttggagtccctctcctggaaaactgtgcagggcctctcccta
caggacctgaccctgtcagggaacccactgcattgttcctgtgccctgttctggctccag
cgttgggagcaggaagggctgtgtggtgtgcatacacagacgcttcatgactctgggcct
ggagaccagttcctcccactgggacacaacaccagttgtggtgtacccacagtgaagatc
cagatgcccaatgactctgtggaagtgggcgatgacgtgtttctgcagtgccaggtggag
gggctggccctacagcaggctgactggatcctcacagagctggaaggggcagccaccgtg
aagaaatttggagatctgccatccctggggctgattctggtcaatgtcaccagtgatctc
aacaagaagaatgtgacgtgctgggcagagaatgatgtgggccgggccgaggtctctgtc
caagtcagcgtctccttcccagccagtgtgcacctgggcctagcggtggagcagcatcat
tggtgcatccccttctcggtggacgggcagccagcaccgtctctgcgctggttgttcaac
ggctctgtgctcaacgagaccagtttcatcttcactcagttcttggagtctgcgctgact
aatgagaccatgcggcacggctgcctgcgcctcaatcagcccacgcatgtcaacaacggg
aactacaccctgctggcggccaacccctacggccaggctgccgcctccgtcatggctgct
tttatggacaacccttttgagttcaaccctgaggaccccatccctgtctccttctcgcca
gtggacggtaacagcacatcaagagacccagtggagaagaaagatgaaaccccttttggg
gtctctgtggctgtgggcctagccgtctctgccgccctcttcctttctgccctccttctt
gtgctcaacaaatgtggacagaggagcaaatttgggatcaaccgccctgctgtattagct
ccagaggatgggctggccatgtccctacacttcatgacactgggtggcagttctctttcc
cctactgagggcaaaggctccggactccagggccacatcatggagaacccacagtacttc
agtgatacctgtgtccatcacatcaagcgccaggacatcattctcaagtgggagctaggg
gagggagcctttggaaaggtctttctcgctgagtgctacaaccttctgaatgatcaggac
aagatgctcgtggctgtcaaggcactgaaggaggcatccgagaatgctcggcaggacttt
cagcgtgaggccgagctgctcaccatgctacagcaccagcacatcgtgcgcttctttgga
gtctgcaccgagggtggcccgttgctcatggtctttgagtacatgcgccacggggacctc
aaccgtttcctccggtcccacggacctgatgcaaagctgctggctggtggtgaggatgtg
gctcctggtcctctgggccttgggcagcttctggctgtggctagccaggtggctgctggt
atggtatatctagccagcctgcactttgtgcaccgggatctggccacacgcaactgtctg
gtgggtcagggactagtggtgaagattggagactttggcatgagcagagacatctatagc
acagactattaccgagtgggaggtcggaccatgctgcccatccgctggatgccacccgag
agcatcctctaccgcaagttcagcaccgagagcgatgtgtggagctttggggtggtgctc
tgggagatcttcacctatggaaagcagccctggtaccagctctccaacactgaggcgatc
gagtgtatcacgcagggccgggagctggagcggccgcgcgcctgccctcctgatgtctac
gccatcatgcgaggctgctggcagcgagaaccgcagcaacgcctcagcatgaaggatgtg
cacgcgcgtctgcaggccctggcacaggcgccacccagttacctggacgttctgggctag

KEGG   Mus musculus (mouse): 18212
Entry
18212             CDS       T01002                                 

Gene name
Ntrk2, GP145-TrkB/GP95-TrkB, Tkr, Tkrb, trk, trk-B, trkB
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 2
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18212 (Ntrk2)
   04014 Ras signaling pathway
    18212 (Ntrk2)
   04020 Calcium signaling pathway
    18212 (Ntrk2)
   04151 PI3K-Akt signaling pathway
    18212 (Ntrk2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18212 (Ntrk2)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    18212 (Ntrk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18212 (Ntrk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18212 (Ntrk2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18212 (Ntrk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 TPKR_C2 Ig_2 ig LRR_8 LRRNT Ig_C17orf99 LRR_5
Other DBs
NCBI-GeneID: 18212
NCBI-ProteinID: NP_001020245
MGI: 97384
Ensembl: ENSMUSG00000055254
UniProt: P15209
Position
13 B1; 13 31.2 cM
AA seq 821 aa
MSPWLKWHGPAMARLWGLCLLVLGFWRASLACPTSCKCSSARIWCTEPSPGIVAFPRLEP
NSVDPENITEILIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAYKAFLKNSNLRHI
NFTRNKLTSLSRRHFRHLDLSDLILTGNPFTCSCDIMWLKTLQETKSSPDTQDLYCLNES
SKNMPLANLQIPNCGLPSARLAAPNLTVEEGKSVTLSCSVGGDPLPTLYWDVGNLVSKHM
NETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVNLTVHFAPTITFLESPTSDHH
WCIPFTVRGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDNPTHMNNGDYT
LMAKNEYGKDERQISAHFMGRPGVDYETNPNYPEVLYEDWTTPTDIGDTTNKSNEIPSTD
VADQSNREHLSVYAVVVIASVVGFCLLVMLLLLKLARHSKFGMKGPASVISNDDDSASPL
HHISNGSNTPSSSEGGPDAVIIGMTKIPVIENPQYFGITNSQLKPDTFVQHIKRHNIVLK
RELGEGAFGKVFLAECYNLCPEQDKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIV
KFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIA
AGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMP
PESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQE
VYELMLGCWQREPHTRKNIKSIHTLLQNLAKASPVYLDILG
NT seq 2466 nt   +upstreamnt  +downstreamnt
atgtcgccctggctgaagtggcatggacccgccatggcgcggctctggggcttatgcctg
ctggtcttgggcttctggagggcctctctcgcctgcccgacgtcctgcaaatgcagttcc
gctaggatttggtgtactgagccttctccaggcatcgtggcattcccgaggttggaacct
aacagcgttgacccggagaacatcacggaaattctcattgcaaaccagaaaaggctagaa
atcatcaatgaagatgacgttgaagcttacgtggggctgagaaaccttacaattgtggat
tccggcttaaagtttgtggcttacaaagcgtttctgaaaaacagcaacctgcggcacata
aatttcacacgaaacaagctgacgagtttgtccaggagacatttccgccaccttgacttg
tctgacctgatcctgacgggtaatccgttcacgtgctcctgcgacatcatgtggctcaag
actctccaggagactaaatccagccccgacactcaggatttgtactgcctcaatgagagc
agcaagaacatgcccctggcgaacctgcagatacccaattgtggtctgccatctgcacgt
ctggctgctcctaacctcaccgtggaggaaggaaagtctgtgaccctttcctgcagtgtg
gggggtgacccactccccaccttgtactgggacgttgggaatttggtttccaagcacatg
aatgaaacaagccacacacagggctccttaaggataacgaacatttcatctgatgacagt
ggaaagcaaatctcttgtgtggcagaaaaccttgtaggagaagatcaagattctgtgaac
ctcactgtgcattttgcgccaactatcacgtttctcgagtctccaacctcagatcaccac
tggtgcattccattcactgtgagaggcaaccccaagcctgcgcttcagtggttctacaat
ggggccatactgaatgagtccaagtacatctgtactaagatccacgtcaccaatcacacg
gagtaccatggctgcctccagctggataaccccactcatatgaataacggagactacacc
ctgatggccaagaacgagtatgggaaggatgagagacagatctccgctcacttcatgggc
cggcctggagtcgactacgagacaaacccaaattaccctgaagtcctctatgaagactgg
accacgccaactgacattggggatactacgaacaaaagtaatgaaatcccctccacggat
gttgctgaccaaagcaatcgggagcatctctcggtctatgccgtggtggtgattgcatct
gtggtgggattctgcctgctggtgatgttgctcctgctcaagttggcgagacattccaag
tttggcatgaaaggcccagcttcggtcatcagcaacgacgatgactctgccagccccctc
caccacatctccaatgggagtaacactccatcttcttcggagggcggtcccgacgctgtc
attattggaatgaccaagattcctgttattgaaaacccccagtactttggcatcaccaac
agtcagctcaagccagacacatttgttcagcatatcaagagacacaacatcgttctgaag
agggaacttggggaaggagccttcgggaaagttttccttgccgagtgctacaacctctgc
ccagagcaggataagatcctggtggctgtgaagacgctgaaggacgccagcgacaatgca
cgcaaggactttcatcgggaagctgagctgctgaccaacctccagcacgagcacattgtc
aagttctacggtgtctgtgtggagggcgacccactcatcatggtctttgagtacatgaag
cacggggacctcaacaagttccttagggcacacgggcccgacgcagtgctgatggcagag
ggtaacccgcccacagagctgacgcagtcgcagatgctgcacatcgctcagcaaatcgca
gcaggtatggtctacctggcgtcccaacactttgtgcaccgtgacctggccacccggaac
tgcctggtgggagagaacctgctggtgaaaattggggactttgggatgtcccgagatgtg
tacagcaccgactactatcgggtcggtggccacacaatgttgcccatccgatggatgcct
ccagagagcatcatgtacaggaaattcaccaccgagagcgacgtctggagcctgggcgtt
gtgttgtgggagatcttcacctacggcaagcagccctggtatcagctatcgaacaatgag
gtgatagagtgcatcacccagggaagagtccttcagcggcctcgaacgtgtccccaggag
gtgtatgagctcatgcttggatgctggcagcgggaaccacacacccggaagaacatcaag
agcatccacaccctccttcagaacttggccaaggcatctcccgtctacctggatatccta
ggctag

KEGG   Mus musculus (mouse): 18595
Entry
18595             CDS       T01002                                 

Gene name
Pdgfra, AI115593, CD140, CD140a, Pdgfr, Pdgfr-2
Definition
(RefSeq) platelet derived growth factor receptor, alpha polypeptide
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18595 (Pdgfra)
   04014 Ras signaling pathway
    18595 (Pdgfra)
   04015 Rap1 signaling pathway
    18595 (Pdgfra)
   04630 JAK-STAT signaling pathway
    18595 (Pdgfra)
   04020 Calcium signaling pathway
    18595 (Pdgfra)
   04072 Phospholipase D signaling pathway
    18595 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    18595 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18595 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18595 (Pdgfra)
   04540 Gap junction
    18595 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18595 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18595 (Pdgfra)
   05206 MicroRNAs in cancer
    18595 (Pdgfra)
   05230 Central carbon metabolism in cancer
    18595 (Pdgfra)
   05231 Choline metabolism in cancer
    18595 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    18595 (Pdgfra)
   05218 Melanoma
    18595 (Pdgfra)
   05215 Prostate cancer
    18595 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18595 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18595 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18595 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18595 (Pdgfra)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18595 (Pdgfra)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18595 (Pdgfra)
CD molecules [BR:mmu04090]
 Proteins
  18595 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 C1-set DUF3475 LAT Kinase-like
Other DBs
NCBI-GeneID: 18595
NCBI-ProteinID: NP_001076785
MGI: 97530
Ensembl: ENSMUSG00000029231
Vega: OTTMUSG00000056081
UniProt: P26618
Position
5 C3.3; 5 39.55 cM
AA seq 1089 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPEIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVSFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaacgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaagtgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggttaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgaccgattccttagtcatcgtg
gaagaggatgactctgccatcataccttgccgcaccacagatccggagactcaagtaacc
ttgcacaataacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacgga
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaatgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccatccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgtgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagattgagcccacc
tttggccagctggaagctgtcaacttgcacgaagtcagagagttcgtggtggaggtgcag
gcctacccgacgcccaggatatcgtggctgaaggacaacttgactctgatagagaatctc
accgagatcaccactgatgtacagaagagtcaggaaacaaggtatcagagcaaattaaag
ctgatccgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattttggatctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgtacagccgaaggcacc
cctcttccagaaatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcaaatattatcacagagctccctcgccgtggc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccact
ctgcgatctgaactcacagtggcggccgcagtgttggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccgagagatggcctcgtgcttggtcggattttggga
tccggtgcatttgggaaagtggtcgaaggtacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaggct
ctcatgtctgagctgaagataatgactcacctggggccacatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataacggcgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctagactcagaagtcaaaaac
ctcctttcggacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgctcgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gcccgcaacgtcctcctggcgcaaggaaaaattgtgaagatctgtgattttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctatgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttctaccacctcagcgagatagtggagaacctgttgccgggacaatacaagaag
agttatgaaaagattcacctggacttcctaaagagtgaccatccggccgtggcacgcatg
cgggtggactctgataatgcgtacatcggtgtcacttacaaaaatgaagaggataagctg
aaggactgggaaggtggcctggacgaacagagactgagcgctgacagtggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcggacctggtggaggacagcttcctgtaa

KEGG   Mus musculus (mouse): 18596
Entry
18596             CDS       T01002                                 

Gene name
Pdgfrb, AI528809, CD140b, PDGFR-1, Pdg, Pdgfr
Definition
(RefSeq) platelet derived growth factor receptor, beta polypeptide
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18596 (Pdgfrb)
   04014 Ras signaling pathway
    18596 (Pdgfrb)
   04015 Rap1 signaling pathway
    18596 (Pdgfrb)
   04630 JAK-STAT signaling pathway
    18596 (Pdgfrb)
   04020 Calcium signaling pathway
    18596 (Pdgfrb)
   04072 Phospholipase D signaling pathway
    18596 (Pdgfrb)
   04151 PI3K-Akt signaling pathway
    18596 (Pdgfrb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18596 (Pdgfrb)
   04540 Gap junction
    18596 (Pdgfrb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18596 (Pdgfrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18596 (Pdgfrb)
   05206 MicroRNAs in cancer
    18596 (Pdgfrb)
   05230 Central carbon metabolism in cancer
    18596 (Pdgfrb)
   05231 Choline metabolism in cancer
    18596 (Pdgfrb)
  09162 Cancer: specific types
   05214 Glioma
    18596 (Pdgfrb)
   05218 Melanoma
    18596 (Pdgfrb)
   05215 Prostate cancer
    18596 (Pdgfrb)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18596 (Pdgfrb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18596 (Pdgfrb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18596 (Pdgfrb)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18596 (Pdgfrb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18596 (Pdgfrb)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18596 (Pdgfrb)
CD molecules [BR:mmu04090]
 Proteins
  18596 (Pdgfrb)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 18596
NCBI-ProteinID: NP_032835
MGI: 97531
Ensembl: ENSMUSG00000024620
Vega: OTTMUSG00000014920
UniProt: P05622
Position
18 E1; 18 34.41 cM
AA seq 1098 aa
MGLPGVIPALVLRGQLLLSVLWLLGPQTSRGLVITPPGPEFVLNISSTFVLTCSGSAPVM
WEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVP
DPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTG
TFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGND
VVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHG
DEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSG
AGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLE
LSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVT
FWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKVVVISAILAL
VVLTVISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPVQLPYDSTWELPRDQLV
LGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPH
LNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRHSNKHCPPSAELYSNALP
VGFSLPSHLNLTGESDGGYMDMSKDESIDYVPMLDMKGDIKYADIESPSYMAPYDNYVPS
APERTYRATLINDSPVLSYTDLVGFSYQVANGMDFLASKNCVHRDLAARNVLICEGKLVK
ICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGG
TPYPELPMNDQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFETRPPFSQLVLLLERL
LGEGYKKKYQQVDEEFLRSDHPAILRSQARFPGIHSLRSPLDTSSVLYTAVQPNESDNDY
IIPLPDPKPDVADEGLPEGSPSLASSTLNEVNTSSTISCDSPLELQEEPQQAEPEAQLEQ
PQDSGCPGPLAEAEDSFL
NT seq 3297 nt   +upstreamnt  +downstreamnt
atggggcttccaggagtgataccagctttagtcctcagaggccagttgttgctgtccgtg
ttatggctcctgggaccgcagacctcccggggcctagtcatcacgccccctgggccagag
tttgttctcaacatctccagcacctttgttctgacctgctcgggctcagctccggtgatg
tgggaacagatgtcccaggtgccctggcaagaagcggccatgaatcaggacggcaccttc
tccagtgtgctgacactgaccaatgtcactgggggagacactggggaatacttttgtgtc
tacaacaactcactagggccggagctcagtgagaggaagcgtatctatatctttgtgcca
gatcccaccatgggcttcctccctatggactccgaggacctgttcatttttgtcacggat
gtcactgagacgacaattccgtgccgagtgacagacccccagctggaggtgacgctacat
gagaagaaagtggatatccccctacacgtaccctacgaccaccagcgaggtttcactggt
acttttgaggacaagacttacatttgcaaaaccaccattggggacagggaagtggactcc
gatacttactacgtctacagcctccaggtgtcatccatcaacgtctctgtgaatgccgtg
cagactgtggtccgccagggcgagagcatcaccatccggtgcattgtgatgggcaatgat
gtggtgaacttccaatggacgtacccccgcatgaagagtgggcggctggtggagccagtg
acagactacctctttggagtgccctcccgcattggctccatcctgcatatccccacggct
gagctgagtgattcgggcacctatacttgcaacgtgtcagtgagtgtgaacgaccatggc
gatgagaaagccatcaacatctctgtgatcgagaatggctacgtgcggctgctggagaca
ctgggagatgtagaaattgctgagctgcaccggagtcggacgctgcgggtggtgttcgag
gcttatccgatgccttctgtcctgtggctcaaggacaaccgtaccttgggtgactccggc
gctggcgagttagttttgtctactcgcaacatgtctgagacccggtacgtgtcagaactg
atcctggtacgtgtgaaggtgtcagaagcgggctactatactatgcgagccttccacgag
gacgatgaggtccagctctccttcaagctgcaggtcaatgtccccgtccgtgtgctggag
ctgagtgagagtcaccctgccaatggggagcagacaatccgctgtcgtggccggggcatg
cctcagccaaatgtcacctggtctacctgcagagacctcaaaaggtgtccacgaaaactg
tcacccacacccttggggaatagttccaaggaggagagccagctagaaacgaatgtgact
ttctgggaggaagatcaggaatacgaggtggtgagcacactgcgcctgcgccacgtggat
cagccactgtccgtacgctgcatgctgcagaactccatgggtggagattcgcaggaggtc
accgtggtcccacattccttgcccttcaaagtggtggtgatctcagccatcctggcctta
gtggtccttaccgtcatctctctcatcatcctcatcatgctgtggcagaagaagccacgc
tatgagatccgatggaaggtcattgagtctgtgagctctgacggtcatgagtacatctac
gtggaccctgtgcagttgccttacgactccacctgggagctgccacgggaccagcttgtt
ctgggacgcactcttggctctggggctttcggacaggtggtggaggccacagctcacggt
ctgagccattcgcaggccaccatgaaagtggctgtcaagatgctgaaatcgacagccaga
agtagcgagaagcaagccttaatgtccgagctgaagattatgagtcatcttggaccccac
ctgaacgtggtcaacctgctgggggcctgcaccaaaggagggcccatctacatcatcacg
gaatactgccgatacggtgatctggtggactacctgcaccggaacaaacacaccttcttg
cagcgacactccaacaagcattgtccgcccagtgctgagctctacagcaacgccctgcca
gtggggttctccctacccagccacttgaacctgactggggagagtgacggtggctacatg
gatatgagcaaggatgaatctatagattacgtgcccatgttggacatgaaaggagacatc
aaatacgcagacattgagtcccccagctacatggccccttatgataactatgtcccatct
gcccctgaaaggacctatcgcgccaccttaatcaacgactcaccagtgctcagctacaca
gacctcgtgggcttcagctaccaagtggccaacggcatggacttcttagcctctaagaac
tgtgttcaccgagacttggcggccaggaatgtgctcatctgcgagggcaagctggtcaag
atctgtgacttcggcctggctcgagacatcatgagggactcaaactacatctccaaaggc
agcaccttcctgcctctgaagtggatggccccagagagcatcttcaacagcctctacacc
actttgagtgatgtctggtcttttgggatcctactctgggagatcttcacactgggtggc
accccttacccagagctgcccatgaacgaccagttctacaatgccatcaagaggggctac
cgcatggcccagcctgctcatgcctccgacgagatctatgagatcatgcagaaatgctgg
gaagaaaagtttgagactcgaccccccttctcccagctggtgctgctcctggagaggctt
ctgggtgaaggctataaaaagaagtaccagcaggtagatgaggagttcctgaggagtgac
catcctgccatcctgaggtcccaagcccgctttccggggatccacagcctccgatcccct
ctggacaccagctctgttctctacactgccgtgcagcccaatgagagtgacaatgactac
atcatccccttacctgaccccaagcctgacgttgctgatgaaggtctcccagaggggtcc
cccagccttgccagttccaccttgaatgaagtcaacacttcctccaccatctcctgcgac
agtcccctggagctccaagaagagccacagcaagcagagcctgaggcacaactggagcag
ccacaggattcaggctgcccaggacctctggctgaagcagaggacagcttcctgtag

KEGG   Mus musculus (mouse): 21687
Entry
21687             CDS       T01002                                 

Gene name
Tek, AA517024, Cd202b, Hyk, STK1, Tie, Tie-2, Tie2, tie-
Definition
(RefSeq) TEK receptor tyrosine kinase
  KO
K05121  endothelial-specific receptor tyrosine kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21687 (Tek)
   04014 Ras signaling pathway
    21687 (Tek)
   04015 Rap1 signaling pathway
    21687 (Tek)
   04066 HIF-1 signaling pathway
    21687 (Tek)
   04151 PI3K-Akt signaling pathway
    21687 (Tek)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    21687 (Tek)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21687 (Tek)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    21687 (Tek)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     21687 (Tek)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TIE family
   21687 (Tek)
CD molecules [BR:mmu04090]
 Proteins
  21687 (Tek)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_Tie2_1 Pkinase fn3 Pur_ac_phosph_N EGF_2 APH hEGF DUF2369 Laminin_EGF DUF4702 Pkinase_fungal
Other DBs
NCBI-GeneID: 21687
NCBI-ProteinID: NP_001277478
MGI: 98664
Ensembl: ENSMUSG00000006386
Vega: OTTMUSG00000007859
UniProt: Q02858
Position
4 C5; 4 43.34 cM
AA seq 1122 aa
MDSLAGLVLCGVSLLLYGVVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGQAIRIRTMKMRQ
QASFLPATLTMTVDRGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPDCSRPCTTCKNNGVCHEDTGEC
ICPPGFMGRTCEKACEPHTFGRTCKERCSGPEGCKSYVFCLPDPYGCSCATGWRGLQCNE
ACPSGYYGPDCKLRCHCTNEEICDRFQGCLCSQGWQGLQCEKEGRPRMTPQIEDLPDHIE
VNSGKFNPICKASGWPLPTSEEMTLVKPDGTVLQPNDFNYTDRFSVAIFTVNRVLPPDSG
VWVCSVNTVAGMVEKPFNISVKVLPEPLHAPNVIDTGHNFAIINISSEPYFGDGPIKSKK
LFYKPVNQAWKYIEVTNEIFTLNYLEPRTDYELCVQLARPGEGGEGHPGPVRRFTTASIG
LPPPRGLSLLPKSQTALNLTWQPIFTNSEDEFYVEVERRSLQTTSDQQNIKVPGNLTSVL
LSNLVPREQYTVRARVNTKAQGEWSEELRAWTLSDILPPQPENIKISNITDSTAMVSWTI
VDGYSISSIIIRYKVQGKNEDQHIDVKIKNATVTQYQLKGLEPETTYHVDIFAENNIGSS
NPAFSHELRTLPHSPASADLGGGKMLLIAILGSAGMTCITVLLAFLIMLQLKRANVQRRM
AQAFQNREEPAVQFNSGTLALNRKAKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKAR
IKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAI
EYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIH
RDLAARNILVGENYIAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVW
SYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYER
PSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
NT seq 3369 nt   +upstreamnt  +downstreamnt
atggactctttagccggcttagttctctgtggagtcagcttgctcctttatggagtagta
gaaggcgccatggacctgatcttgatcaattccctacctcttgtgtctgatgccgaaaca
tccctcacctgcattgcctctgggtggcacccccatgagcccatcaccataggaagggac
tttgaagccttaatgaaccagcaccaagatccactggaggttactcaagatgtgaccaga
gaatgggcgaaaaaagttgtttggaagagagaaaaggccagtaagattaatggtgcttat
ttctgtgaaggtcgagttcgaggacaggctataaggatacggaccatgaagatgcgtcaa
caagcatccttcctacctgctactttaactatgaccgtggacaggggagataatgtgaac
atatctttcaaaaaggtgttaattaaagaagaagatgcagtgatttacaaaaatggctcc
ttcatccactcagtgccccggcatgaagtacctgatattttagaagttcacttgccgcat
gctcagccccaggatgctggtgtgtactcggccaggtacataggaggaaacctgttcacc
tcagccttcaccaggctgattgttcggagatgtgaagctcagaagtgggggcccgactgt
agccgtccttgtactacttgcaagaacaatggagtctgccatgaagataccggggaatgc
atttgccctcctgggtttatggggagaacatgtgagaaagcttgtgagccgcacacattt
ggcaggacctgtaaagaaaggtgtagtggaccagaaggatgcaagtcttatgtgttctgt
ctcccagacccttacgggtgttcctgtgccacaggctggagggggttgcagtgcaatgaa
gcatgcccatctggttactacggaccagactgtaagctcaggtgccactgtaccaatgaa
gagatatgtgatcggttccaaggatgcctctgctctcaaggatggcaagggctgcagtgt
gagaaagaaggcaggccaaggatgactccacagatagaggatttgccagatcacattgaa
gtaaacagtggaaaatttaaccccatctgcaaagcctctgggtggccactacctactagt
gaagaaatgaccctagtgaagccagatgggacagtgctccaaccaaatgacttcaactat
acagatcgtttctcagtggccatattcactgtcaaccgagtcttacctcctgactcagga
gtctgggtctgcagtgtgaacacagtggctgggatggtggaaaagcctttcaacatttcc
gtcaaagttcttccagagcccctgcacgccccaaatgtgattgacactggacataacttt
gctatcatcaatatcagctctgagccttactttggggatggacccatcaaatccaagaag
cttttctataaacctgtcaatcaggcctggaaatacattgaagtgacgaatgagattttc
actctcaactacttggagccgcggactgactacgagctgtgtgtgcagctggcccgtcct
ggagagggtggagaagggcatcctgggcctgtgagacgatttacaacagcgtctatcgga
ctccctcctccaagaggtctcagtctcctgccaaaaagccagacagctctaaatttgact
tggcaaccgatatttacaaactcagaagatgaattttatgtggaagtcgagaggcgatcc
ctgcaaacaacaagtgatcagcagaacatcaaagtgcctgggaacctgacctcggtgcta
ctgagcaacttagtccccagggagcagtacacagtccgagctagagtcaacaccaaggcg
cagggggagtggagtgaagaactcagggcctggacccttagtgacattctccctcctcaa
ccagaaaacatcaagatctccaacatcactgactccacagctatggtttcttggacaata
gtggatggctattcgatttcttccatcatcatccggtataaggttcagggcaaaaatgaa
gaccagcacattgatgtgaagatcaagaatgctaccgttactcagtaccagctcaagggc
ctagagccagagactacataccatgtggatatttttgctgagaacaacataggatcaagc
aacccagccttttctcatgaactgaggacgcttccacattccccagcctctgcagacctc
ggagggggaaagatgctactcatagccatccttgggtcggctggaatgacttgcatcacc
gtgctgttggcgtttctgattatgttgcaactgaagagagcaaatgtccaaaggagaatg
gctcaggcattccagaacagagaagaaccagctgtgcagtttaactcaggaactctggcc
cttaacaggaaggccaaaaacaatccggatcccacaatttatcctgtgcttgactggaat
gacatcaagtttcaagacgtgatcggagagggcaactttggccaggttctgaaggcacgc
atcaagaaggatgggttacggatggatgccgccatcaagaggatgaaagagtatgcctcc
aaagatgatcacagggacttcgcaggagaactggaggttctttgtaaacttggacaccat
ccaaacatcattaatctcttgggagcatgtgaacaccgaggctatttgtacctagctatt
gagtatgccccgcatggaaacctcctggacttcctgcgtaagagcagagtgctagagaca
gaccctgcttttgccatcgccaacagtacagcttccacactgtcctcccaacagcttctt
cattttgctgcagatgtggcccgggggatggactacttgagccagaaacagtttatccac
agggacctggctgccagaaacattttagttggtgaaaactacatagccaaaatagcagat
tttggattgtcacgaggtcaagaagtgtatgtgaaaaagacaatgggaaggctcccagtg
cgttggatggcaatcgaatcactgaactatagtgtctatacaaccaacagtgatgtctgg
tcctatggtgtattgctctgggagattgttagcttaggaggcaccccctactgcggcatg
acgtgcgcggagctctatgagaagctaccccagggctacaggctggagaagcccctgaac
tgtgatgatgaggtgtatgatctaatgagacagtgctggagggagaagccttatgagaga
ccatcatttgcccagatattggtgtccttaaacaggatgctggaagaacggaagacatac
gtgaacaccacactgtatgagaagtttacctatgcaggaattgactgctctgcggaagaa
gcagcctag

DBGET integrated database retrieval system