KEGG   Mus musculus (mouse): 12981Help
Entry
12981             CDS       T01002                                 

Gene name
Csf2, CSF, Csfgm, GMCSF, Gm-CSf, MGI-IGM
Definition
(RefSeq) colony stimulating factor 2 (granulocyte-macrophage)
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04630  Jak-STAT signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04650  Natural killer cell mediated cytotoxicity
mmu04657  IL-17 signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu05146  Amoebiasis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    12981 (Csf2)
   04668 TNF signaling pathway
    12981 (Csf2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12981 (Csf2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12981 (Csf2)
   04650 Natural killer cell mediated cytotoxicity
    12981 (Csf2)
   04660 T cell receptor signaling pathway
    12981 (Csf2)
   04657 IL-17 signaling pathway
    12981 (Csf2)
   04664 Fc epsilon RI signaling pathway
    12981 (Csf2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12981 (Csf2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    12981 (Csf2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    12981 (Csf2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12981 (Csf2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12981 (Csf2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    12981 (Csf2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12981 (Csf2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12981 (Csf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12981 (Csf2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     12981 (Csf2)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12981 (Csf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Cytokines
   12981 (Csf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF DUF3937
Motif
Other DBs
NCBI-GeneID: 12981
NCBI-ProteinID: NP_034099
MGI: 1339752
Ensembl: ENSMUSG00000018916
Vega: OTTMUSG00000005663
UniProt: P01587 Q5SX78
Position
11 B1.3; 11 32.13 cM
AA seq 141 aa AA seqDB search
MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNE
FSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADF
IDSLKTFLTDIPFECKKPGQK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagaatttacttttcctgggcattgtggtctacagcctctcagcacccacc
cgctcacccatcactgtcacccggccttggaagcatgtagaggccatcaaagaagccctg
aacctcctggatgacatgcctgtcacgttgaatgaagaggtagaagtcgtctctaacgag
ttctccttcaagaagctaacatgtgtgcagacccgcctgaagatattcgagcagggtcta
cggggcaatttcaccaaactcaagggcgccttgaacatgacagccagctactaccagaca
tactgccccccaactccggaaacggactgtgaaacacaagttaccacctatgcggatttc
atagacagccttaaaacctttctgactgatatcccctttgaatgcaaaaaaccaggccaa
aaatga

DBGET integrated database retrieval system